SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for M3Y832 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  M3Y832
Domain Number 1 Region: 1417-1522
Classification Level Classification E-value
Superfamily PDZ domain-like 7.1e-28
Family PDZ domain 0.018
Further Details:      
 
Domain Number 2 Region: 232-329
Classification Level Classification E-value
Superfamily PDZ domain-like 1.31e-26
Family PDZ domain 0.011
Further Details:      
 
Domain Number 3 Region: 1659-1762
Classification Level Classification E-value
Superfamily PDZ domain-like 2.5e-24
Family PDZ domain 0.0039
Further Details:      
 
Domain Number 4 Region: 1228-1326
Classification Level Classification E-value
Superfamily PDZ domain-like 1.24e-23
Family PDZ domain 0.027
Further Details:      
 
Domain Number 5 Region: 1063-1162
Classification Level Classification E-value
Superfamily PDZ domain-like 2.37e-22
Family PDZ domain 0.0002
Further Details:      
 
Domain Number 6 Region: 5-64
Classification Level Classification E-value
Superfamily L27 domain 5.49e-22
Family L27 domain 0.0000656
Further Details:      
 
Domain Number 7 Region: 1523-1614
Classification Level Classification E-value
Superfamily PDZ domain-like 3.15e-21
Family PDZ domain 0.0032
Further Details:      
 
Domain Number 8 Region: 678-773
Classification Level Classification E-value
Superfamily PDZ domain-like 1.25e-20
Family PDZ domain 0.013
Further Details:      
 
Domain Number 9 Region: 117-225
Classification Level Classification E-value
Superfamily PDZ domain-like 3.86e-20
Family PDZ domain 0.0065
Further Details:      
 
Domain Number 10 Region: 383-452
Classification Level Classification E-value
Superfamily PDZ domain-like 1.31e-18
Family PDZ domain 0.0041
Further Details:      
 
Domain Number 11 Region: 571-640
Classification Level Classification E-value
Superfamily PDZ domain-like 0.00000000000000101
Family PDZ domain 0.025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) M3Y832
Sequence length 1803
Comment (tr|M3Y832|M3Y832_MUSPF) PATJ, crumbs cell polarity complex component {ECO:0000313|Ensembl:ENSMPUP00000007489} KW=Complete proteome; Reference proteome OX=9669 OS=Mustela putorius furo (European domestic ferret) (Mustela furo). GN=PATJ OC=Mustelinae; Mustela.
Sequence
MPENPAPDKLQVLQVLDRLKMKLQEKGDTSQNEKLSLFYETLKSPLFNQILTLQQSIRQL
KGQLSHIPSDCSANFDFSRKGLLVFTHGAIPNGNAQRPSNNSTVSGLFPWTPKSANEDFK
SVIQQMAQGRQIEYIDIERPSSGGLGFSVVALRSHSLGQVDVFVKEVQPGSVVDRDQRLR
ENDQILAINDTPLDQNISHQQAIALLQQTTGSLRLVVARELAHTKTSASLTDPTLPETVH
WGHIEDVELINDGSGLGFGIVGGKSSGVVVRTIVPGGLADRDGRLQTGDHILKIGGTDVQ
GMTSEQVAQVLRNCGNSVRMLVARAPVGAVSVTPPTPAALPVALPAVAHKSPSANLNEFQ
KRNIESLVSVNFCLGGMAIGSAGEKCLGEASGIYVKSIIPGSAAYHNGQIQVNDKIVAVD
GVDIQGFANQDVVEVLRNAGQVVHLTLVRRVQREASSSASPLEWPSDPGTAVEPSETPAR
YLTGAVETETDLDGGDEETEERMDNLKNDNMQGVEKLEKVPDSPENELKSRWENLLGPDY
EVMVATLDTQIADDAELQKYSKLLPIHTLRLGMEVDSFDGHHYISSVAPGGPVDTLNLLQ
PEDELLEVNGVQLYGKSRREAVSFLKEVPPPFTLVCCRRLFDDEASVDEPRTTEAPLPKM
EADHSVEVGTEEDDDGELALWSPEVKIVELVKDHKGLGFSILDYQDPLDPTRSVIVIRSL
VADGVAERGGELLPGDRLVSVNECCLENTTLAEAVDVLKAVPPGIVRLGICKPLVEDDKE
EESHYILHSNNEDKTELSETIHDINSSLILEAPKEFRDEPYYKEELVDEPFLNLGKAFQS
EQKEIDHSKEAWEMHEFLIPRLQEMGEEREMLVDDEYELYQDHLQSVDLYLSSHLQEAAP
VPSAKELHFGTQWLRDSAPPELQGARSMVSLYSPEAQQYGYSTENMMKENFGISSLPSIP
SSEGNSQQGRFDDLENLNSLTKSSLDLGMMIPNDVPGPGLLVELPDVAQRREQEDLSLYQ
LPRTRVVSKASAYTAPSSSRYTADACELPEREEGEGEETPNFSHWGPPRIVEIFREPNVS
LGISIVGGQTVIKRLKNGEELKGIFIKQVLEDSPAGKTNALKTGDKILEVSGVDLQNASH
REAVEAIKNAGNPVVFVVQSLSSTPRVLPSVHNKANKIANNQDQNTEEKKEKRQGTAPPP
MKLPPPYKAPSDDSDENEEEYAFTNKKIRQRYADLPGELHIIELEKDKNGLGLSLAGNKD
RSRMSIFVVGINPEGPAALDGRMRIGDELLEINNQILYGRSHQNASAIIKTAPSKVKLVF
IRNEDAVSQMAVAPFPVPSSSPSSVEDQSGTEPVSSEEDGSLEVGIKQLPENESSKLAVS
QMKQQQKNSTKVSFSSQEIPLAPSYHSVDADFTNYGGFQAPLSVDPATCPIVPGQEMIIE
ISKGRSGLGLSIVGGKDTPLDAIVIHEVYEEGAAARDGRLWAGDQILEVNGVDLRSAGHE
EAITALRQTPQKVRLVVYRDEAHYRDEENLEIFPVDLQKKAGRGLGLSIVGKRNGNGVFI
SDIVKGGAADLDRRLIQGDQILSVNGEDMRNASQETVATVLKCAQGLVQLEIGRLRAGSW
TSSRKTSQNSQGSQHSTHSSFHPSLAPVITSLQNLVGTKRAPDPSPKSSGTDMGPRTVEI
VRELSDALGISIAGGKGSPLGDIPIFIAMIQASGVAARTQKLKVGDRIVSINGQPLDGLS
HADVVNLLKNAYGRIILQVVADTNISAIATQLEHMSPSYHLGSPTAEHHPEDTEKQSLPL
TMD
Download sequence
Identical sequences M3Y832
ENSMPUP00000007489 ENSMPUP00000007489

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]