SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for M3Y8T1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  M3Y8T1
Domain Number 1 Region: 1-88
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 2.14e-21
Family THAP domain 0.00043
Further Details:      
 
Weak hits

Sequence:  M3Y8T1
Domain Number - Region: 335-391
Classification Level Classification E-value
Superfamily Tropomyosin 0.0785
Family Tropomyosin 0.0091
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) M3Y8T1
Sequence length 394
Comment (tr|M3Y8T1|M3Y8T1_MUSPF) THAP domain containing 5 {ECO:0000313|Ensembl:ENSMPUP00000007738} KW=Complete proteome; Reference proteome OX=9669 OS=Mustela putorius furo (European domestic ferret) (Mustela furo). GN=THAP5 OC=Mustelinae; Mustela.
Sequence
MPRYCAAVCCKNRRGRNSKDRKLSFYPFPLHDKERLEKWLKNMKRDSWVPSKYQFLCSDH
FTPDSLDVRWGIRYLKQTAIPTIFSLPEDNQEKDSSKKKSQKKKLDDEKEVCLKAKSQES
FASNELKKNTVNTDILPEHTELLNSSTLVKLPAPKPEGIQNNILTLNLVKQDIKKPVSTL
ETSVTQDIDIGGFHTSFENLNSTTITLTTSNSEDIQPSLETQEVFEITTNHLANPNFTNN
SMEIKSAQESPFLFSTITKTVEELNANKESVIAIFVPTENSKPINSFVSTEKETVEMGDL
DPEGSLYKDIDYETEVLQIEHSYCRQDINKEHLWRKVSKLHSKITLLELQEQQTLGRLKS
LEALIRQLKQEHWLSEENVKIIENHFTTYEVTML
Download sequence
Identical sequences M3Y8T1
ENSMPUP00000007738 ENSMPUP00000007738 XP_004742006.1.14098

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]