SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for M3Y8W0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  M3Y8W0
Domain Number 1 Region: 980-1107
Classification Level Classification E-value
Superfamily PH domain-like 4.46e-21
Family Pleckstrin-homology domain (PH domain) 0.0044
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) M3Y8W0
Sequence length 1124
Comment (tr|M3Y8W0|M3Y8W0_MUSPF) Anillin actin binding protein {ECO:0000313|Ensembl:ENSMPUP00000007767} KW=Complete proteome; Reference proteome OX=9669 OS=Mustela putorius furo (European domestic ferret) (Mustela furo). GN=ANLN OC=Mustelinae; Mustela.
Sequence
MDPFTEKLLERTRARRENLQRKMAERPTAAARSMTHAKRAREPLSEASNQQPLPGSEEKS
CTKPSPSKKRCSDTTEVAEVSNLENEKPVESASAKPCPPSPPAPQAQPQAPAPVSASETA
PAPVPRVRRGLNSRLESTAGSSVKTRMQKLAEQRRHWDNNDLTDDIPESSVISPMPSEEK
AASPPKPALSDASATPVGRRGRLANLAATICSWEDDVNYSSAKQHSAQEQPGTTCLSKFS
SASGASARINSSSVKQEATCCSQRDGEASLNKAPSSSAVGVSLNNAAISSSVKAASSPVK
SSTTAITDAKNCNGQNPELLQKTPVSPLKTEISKPIEKSTVSQTFRPKEELNRETCRQSQ
SKDKAATSGGAGIKPFLERFGERCQEHSKQSPARSTPHRTPVITPNTRAIQERLFQQNTS
SSTTHLAQQLKQEREKELACLRGRFDKGNLWSAEKGETSRSKQLETKQEIHCQNTPLKKH
PAVSNTPSVPVTEKVTENQTPGKPSNTEPTGFTECEMTKSSPLKITLFLEEDKSLKVTSE
PKVEQQTEVVRETEMSVDDDDDINSSKVINDIFSDVLVEGELDMEKSEEEMDHEEQEDAL
NISSMSLLAPLAQTVGVVSPESLVSSPRLELKDSSVSDESPKPGKFQRTRVPRAESGDSI
GSEDRDLLYSIDAYRSQRFKETERPSIKQVIVRKEDVTSKLDEKKNGFPGQVNIKQKMQE
LNNEINLQQTVIYQASQALNCCVDEDHGKGSLEEAEAERLLLIATEKRAFLIDELNKLKN
EGPQKKNKAGPIAPSEFVPSKGSVTLSEIRLPLKADFVCGTVQKPDAANYYFLIILKAGP
ENMVATPLACTSNSLNGDALTFTTTFTLQDVSNDFEINIEVYSLVQKKDLSGPDKKKKAY
KSKAITPKRLLTSITTKSSLHSSVMASPGGLNAVRTSNFALVGSYMLSLSSVGNTKFALD
KVPFLSPLEGHIYLKIKCQVNSSVEERGFLTIFEDVSGFGAWHRRWCVLSGNCISYWTYP
DDEKRKNPIGRINLANCTSHQIEPANREFCARRNTFELITVRPQREDDRETLVSQCRDTL
CVTKNWLSADTKEERDLWMQKLNQILVDIRLWQPDACYKPIGKP
Download sequence
Identical sequences M3Y8W0
ENSMPUP00000007767 XP_004742028.1.14098 ENSMPUP00000007767

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]