SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for M3Y8Z5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  M3Y8Z5
Domain Number - Region: 69-167
Classification Level Classification E-value
Superfamily PH domain-like 0.000344
Family Enabled/VASP homology 1 domain (EVH1 domain) 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) M3Y8Z5
Sequence length 191
Comment (tr|M3Y8Z5|M3Y8Z5_MUSPF) Uncharacterized protein {ECO:0000313|Ensembl:ENSMPUP00000007802} KW=Complete proteome; Reference proteome OX=9669 OS=Mustela putorius furo (European domestic ferret) (Mustela furo). GN= OC=Mustelinae; Mustela.
Sequence
MSNEMSFSFSTNSARLASLFGLDQASAGHGNEFFQYTAPKQPKKGPGAAATGNLAPAKAA
LPPAGTFTVLVAAAVHAYRYTNGQYVKQGKFGAAVLGNHTAREYKILLYISQQQSVTVAR
IHLNFELMVRPNNYSTFYDDQRQNWSIMFESEKAAVEFNKQVILTYSSCERPGFPLILGN
CMENSQPALFC
Download sequence
Identical sequences M3Y8Z5
ENSMPUP00000007802 ENSMPUP00000007802

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]