SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for M3Y9A0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  M3Y9A0
Domain Number 1 Region: 348-652
Classification Level Classification E-value
Superfamily PLC-like phosphodiesterases 1.44e-114
Family Mammalian PLC 0.00000038
Further Details:      
 
Domain Number 2 Region: 188-346
Classification Level Classification E-value
Superfamily EF-hand 4.04e-39
Family EF-hand modules in multidomain proteins 0.016
Further Details:      
 
Domain Number 3 Region: 673-797
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 1.22e-31
Family PLC-like (P variant) 0.00036
Further Details:      
 
Domain Number 4 Region: 59-172
Classification Level Classification E-value
Superfamily PH domain-like 7.24e-26
Family Pleckstrin-homology domain (PH domain) 0.0014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) M3Y9A0
Sequence length 1045
Comment (tr|M3Y9A0|M3Y9A0_MUSPF) Phosphoinositide phospholipase C {ECO:0000256|RuleBase:RU361133} KW=Complete proteome; Reference proteome OX=9669 OS=Mustela putorius furo (European domestic ferret) (Mustela furo). GN=PLCL1 OC=Mustelinae; Mustela.
Sequence
MSNCNYDTENARLVCWSHSQPRRVCTHIFQDPSNQKCGGRKKTVSFSSMPSEKKISSASD
CISFMQAGCELKKVRPNSRIYNRFFTLDTDLQALRWEPSKKDLEKAKLDISAIKEIRLGK
NTETFRNNGLADQICEDSAFSILHGENYESLDLVANSADVANIWVSGLRYLVSRSKQPLD
FMEDNQNTPRFMWLKTVFEAADVDGNGIMLEDTCVELIKQLNPTLKESKIRLKFKEIQKS
KEKLTTRVTEEEFCEAFCELCTRPEVYFLLVQISKNKEYLDANDLMLFLEAEQGVTHITE
DMCLDIIRRYELSEEGRQKGFLAIDGFTQYLLSPECDIFDPEQKKVAQDMTQPLSHYYIN
ASHNTYLIEDQFRGPADINGYVRALKMGCRSIELDVSDGSDNEPILCNRNNVTTHLSFRS
VLEVINKFAFVASEYPLILCLGNHCSLPQQKIMVQQMKKVFGDKLYTEAPLPSETYLPSP
EKLKRMIIVKGKKLPSDPDILEGEVTDEDEEAEMSRRLSVDYNGEQKHILLCRELSDLVS
ICKSVQYRDFELSMKSQNYWEMCSFSETEASRIANEYPEDFVNYNKRFLSRIYPSAMRID
SSNLNPQDFWNCGCQIVAMNFQTPGPMMDLHTGWFLQNGGCGYVLRPSIMRDEVSYFSAN
TKGIVPGVSPLALHIKIISGQNFPKPKGACAKGDVIDPYVCIEIHGIPADCSEQRTKTVQ
QNSDNPIFDETFEFQVNLPELAMIRFVVLDDDYIGDEFIGQYTIPFECLQPGYRHVPLRS
FVGDIMEHVTLFVHIAITNRSGGGKAQKRSLSVRMGKKVREYTMLRNIGLKTIDDIFKIA
VHPLREAIDMRENMQNAIVSIKELCGLPPTASLKQCLLTLSSRLITSDSTPSVSLVMKDN
FPYLEPLGAIPDVQKKMLAAYDLMIQESRFLIEMADTVQEKIVQCQKAGMEFREELHHLG
AKEGLKGRKLNKATESFAWNITVLKGQGDLLKNAKNEAVENMKQIQLACLSCGLSKAPSS
GAEAKSRRSLEAIEEKESSEENGKL
Download sequence
Identical sequences M3Y9A0
ENSMPUP00000007907 ENSMPUP00000007907

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]