SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for M3Y9D3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  M3Y9D3
Domain Number 1 Region: 21-69
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 9.51e-16
Family LIM domain 0.00078
Further Details:      
 
Domain Number 2 Region: 142-189
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 9.73e-16
Family LIM domain 0.0013
Further Details:      
 
Domain Number 3 Region: 102-141
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.00000000000357
Family LIM domain 0.0063
Further Details:      
 
Weak hits

Sequence:  M3Y9D3
Domain Number - Region: 3-20
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.0238
Family LIM domain 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) M3Y9D3
Sequence length 196
Comment (tr|M3Y9D3|M3Y9D3_MUSPF) Cysteine rich protein 2 {ECO:0000313|Ensembl:ENSMPUP00000007940} KW=Complete proteome; Reference proteome OX=9669 OS=Mustela putorius furo (European domestic ferret) (Mustela furo). GN=CRIP2 OC=Mustelinae; Mustela.
Sequence
PVSPAEKVSSLGKDWHKFCLKCERCSKTLTPGGHAEHDGKPFCHKPCYATLFGPKGVNIG
GAGSYIYEKPAAEGPQVTGPVQVPAARAEERKAGGPPKGPSRASSVTTFTGEPNVCPGCN
KRVYFAEKVTSLGKDWHRPCLRCGRCGKTLTPGGHAEHDGQPYCHKPCYGILFGPKGVNT
GAVGSYIYDRDPEGKV
Download sequence
Identical sequences M3Y9D3
ENSMPUP00000007940 ENSMPUP00000007940

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]