SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for M3Y9F7 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  M3Y9F7
Domain Number 1 Region: 21-304
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 1.26e-46
Family FCH domain 0.0063
Further Details:      
 
Domain Number 2 Region: 549-632
Classification Level Classification E-value
Superfamily SH3-domain 1.81e-17
Family SH3-domain 0.0018
Further Details:      
 
Domain Number 3 Region: 457-533
Classification Level Classification E-value
Superfamily SH3-domain 0.0000000000000184
Family SH3-domain 0.0016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) M3Y9F7
Sequence length 693
Comment (tr|M3Y9F7|M3Y9F7_MUSPF) FCH and double SH3 domains 1 {ECO:0000313|Ensembl:ENSMPUP00000007964} KW=Complete proteome; Reference proteome OX=9669 OS=Mustela putorius furo (European domestic ferret) (Mustela furo). GN=FCHSD1 OC=Mustelinae; Mustela.
Sequence
MQPPPRKVKPAQEVKLRFLEQLNILQTRQQREADLLEDIRSYSKQRAAIEREYGQALQKL
AGPFLKREGHRSGEMDSRRGRMVFGAWRCLLDATVAGGQARLQASDRYRDLAGGTGRSAK
EQVLRKGAENLQRAQAEVLQSVRELSRSRKLYGQRERVWALAQEKAADVQARLNRSDHGL
FHTRASLQKLSTKLSAQSAQYSQQLRAARNEYLLNLVATNAHLDHYYQEELPALLKALVS
ELLEHLRDPLTLLSRTELEAAEMALEHARRGGQATSQVSWEEDLKLFLQEPGVFSPTPPQ
EFQPAGTDQVCTLELEGDAGGMAGDRSLEKEVQRWTSRAARDYKIQNHGHRVLQRLEQRR
QQAPGREAPGLEQRLQEVRESIRRAQVSQVKGAARLALLQGAGLDVQRWLKPAMTQAQDE
VEQERRLSEARLSQRDLSPTAEDAELSDFEECEETGELFEEPAPVALATRPLPCPAHVVF
SYQAGHEDELTITEGEWLEVIEEGDADEWVKARNQHGEVGFVPERYLNFPDLSFPESGHD
SDNPSGVEPTAFLARALYSYTGQSAEELSFPEGALIRLLPRAQDGVDDGFWRGEFGGHVG
VFPSLLVEELLGPPEPPELSDPEQMLPSPSPPSFSPPVPTSALEGAPASALPVDQDLDCP
GPLDMMVPRLRPMRPPPPPPAKAPDPGHPDSLT
Download sequence
Identical sequences M3Y9F7
ENSMPUP00000007964 ENSMPUP00000007964

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]