SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for M3Y9G4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  M3Y9G4
Domain Number 1 Region: 221-366
Classification Level Classification E-value
Superfamily Ribonuclease H-like 0.000000000000455
Family Retroviral integrase, catalytic domain 0.014
Further Details:      
 
Weak hits

Sequence:  M3Y9G4
Domain Number - Region: 71-184
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 0.068
Family FCH domain 0.037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) M3Y9G4
Sequence length 441
Comment (tr|M3Y9G4|M3Y9G4_MUSPF) KRAB-A domain containing 2 {ECO:0000313|Ensembl:ENSMPUP00000007971} KW=Complete proteome; Reference proteome OX=9669 OS=Mustela putorius furo (European domestic ferret) (Mustela furo). GN=KRBA2 OC=Mustelinae; Mustela.
Sequence
LRASGKACCMDTMLDGYENVVPQGSFLQLSTMPQKPGNDPPHVSTTSDTETEIHHMREKF
LASVTKLVESKSYNSKVFSKEKYFQTIKEVKEAKEKGKKSSRDYRRAAKYDVISVQGTEK
LIKATHGERDRIRYYVHKEELFDILHDTHLNIGHGGRTRMLKELQGKYGNVTKEVIVLYL
TLCKQCYQKNPVPKRGLAPKPMPSKDTDSRCQVEVLDMQSNADGEFKFILYYQDHLTKFI
ILRPLKAKRAHEVVIVLLDIFTILGTPRVLDSGSGVEFTNQVVHELSKVWPDLKVACGKQ
RPGQGPGSLEQVSHDVKNMVRAWMQSNRSCCWAEGLRFIQMARNQMFDVSLQRSPYEAMF
GFKAKLGLYSSHLPRETVAILQTEEELEIAEEQLESSLWRGQEERTEVAADRSDVDEDLD
PTAPEAAEPSTSQGAPRLFCW
Download sequence
Identical sequences M3Y9G4
ENSMPUP00000007971 ENSMPUP00000007971

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]