SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for M3Y9L2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  M3Y9L2
Domain Number 1 Region: 30-74
Classification Level Classification E-value
Superfamily RING/U-box 0.0000203
Family RING finger domain, C3HC4 0.017
Further Details:      
 
Weak hits

Sequence:  M3Y9L2
Domain Number - Region: 77-166
Classification Level Classification E-value
Superfamily TRAF domain-like 0.034
Family SIAH, seven in absentia homolog 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) M3Y9L2
Sequence length 215
Comment (tr|M3Y9L2|M3Y9L2_MUSPF) Ring finger protein 166 {ECO:0000313|Ensembl:ENSMPUP00000008019} KW=Complete proteome; Reference proteome OX=9669 OS=Mustela putorius furo (European domestic ferret) (Mustela furo). GN=RNF166 OC=Mustelinae; Mustela.
Sequence
MTLSRNSRGELPCEVAGSQQPSGPCRVPGRFCGECLQPCLQVPSPLCPLCRLPFDPKKVD
KAVHVEKQLSSYKAPCRGCSKKVTLAKMRVHVSSCMKVQEQMANCPKFVPVVPTSQPIPS
AVPNRSTFTCPYCGARNLDQQELLKHCVDNHRSDPNRVVCPICSAMPWGDPSYKSANFLQ
HLLHRHKFSYDTFVDYSIDEEAAFQAALALSLSEN
Download sequence
Identical sequences M3Y9L2
ENSMPUP00000008019 ENSMPUP00000008019

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]