SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for M3Y9R8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  M3Y9R8
Domain Number 1 Region: 222-419
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 1.07e-56
Family Prokaryotic proteases 0.0000000161
Further Details:      
 
Domain Number 2 Region: 434-530
Classification Level Classification E-value
Superfamily PDZ domain-like 1.97e-23
Family HtrA-like serine proteases 0.0000164
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) M3Y9R8
Sequence length 533
Comment (tr|M3Y9R8|M3Y9R8_MUSPF) HtrA serine peptidase 2 {ECO:0000313|Ensembl:ENSMPUP00000008075} KW=Complete proteome; Reference proteome OX=9669 OS=Mustela putorius furo (European domestic ferret) (Mustela furo). GN=HTRA2 OC=Mustelinae; Mustela.
Sequence
MPRGPLGHLITRVPRGPQFPAFARRGGVGLLESWVRRALLEDFRYRRAPRPSVRQLASRA
PPLCRAGEKAAEAELMAALRAGRGAGWSLRGWRALGGVRWGKGPLLTPDLRALLTSGTPD
PRARVTYGTPSLRARLSVGVPEPRTCLTSGTSDSRARLTAGTPDSRTREVSGTPGTRSRV
WLAVALGAGGAVLLLLWGGGRGPPAVLASVLGPPPTSPRSQYNFIADVVEKTAPAVVYIE
ILGRHPFSGREVPISNGSGFVVAADGLIVTNAHVVADRRRVRVRLLSGDTYEAMVTAVDP
VADIATLRIQTKEPLPTLPLGRSADVRQGEFVVAMGSPFALQNTITSGIVSSAQRPARDL
GLPQTNVEYIQTDAAIDFGNSGGPLVNLDGEVIGVNTMKVTAGISFAIPSDRLREFLHRG
EKKNSWFGISGSQRRYIGVMMLTLTPSILAELQLREPSFPDVQHGVLIHKVILDSPAHRA
GLRPGDVILAIGEQLVQNAEDIYEAVRTQSQLAVRIRRGPETLTLYVTPEVTE
Download sequence
Identical sequences M3Y9R8
ENSMPUP00000008075 ENSMPUP00000008075

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]