SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for M3Y9S0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  M3Y9S0
Domain Number 1 Region: 419-453
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.0000446
Family LIM domain 0.064
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) M3Y9S0
Sequence length 597
Comment (tr|M3Y9S0|M3Y9S0_MUSPF) GATA zinc finger domain containing 2B {ECO:0000313|Ensembl:ENSMPUP00000008077} KW=Complete proteome; Reference proteome OX=9669 OS=Mustela putorius furo (European domestic ferret) (Mustela furo). GN=GATAD2B OC=Mustelinae; Mustela.
Sequence
MDRMTEDALRLNLLKRSLDPADERDDVLAKRLKMEGHEAMERLKMLALLKRKDLANLEVP
HELPTKQDGGGIKGYEEKLNGSLRPHGDGRAAGRPGKENISDEPVDMSARRRTPNNGKLP
ESEPLKILFLSNLKAVSPCGHSSVLPEVWLIAVYLWSGKGMEERQQLIKQLRDELRLEEA
RLVLLKKLRQSQLQKENVVQKTPVVQNAASIVQPAPAHGGQQGLSKLPSRPGAQGVEPQS
LRTLQGHSVIRSAANTALPHMLMSQRVIAPNPAQLQGQRGPPKPGLVRTTTPSMNPAINY
QPQSSSSVPCQRTASSAIYMNLASHIQPGTVNRVSSPLPSPSAMTDAANSQAAAKLALRK
QLEKTLLEIPPPKPPAPLLHFLPSAANSEFIYMVGLEEVVQSVIDSQGKSCASLLRVEPF
VCAQCRTDFTPHWKQEKNGKILCEQCMTSNQKKALKAEHTNRLKNAFVKALQQEQEIEQR
LQQQAALSPTAAPAVSSVSKQDTIMRHHTLRQAPQPQSSLQRGIPTSARSMLSNFAQAPQ
LSVPGGLLGMPGPGVNIAYLNTGIGGHKAPSLADRQREYLLDMIPPRSIAQSISGQK
Download sequence
Identical sequences M3Y9S0
ENSMPUP00000008077 ENSMPUP00000008077

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]