SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for M3Y9T4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  M3Y9T4
Domain Number 1 Region: 3-310
Classification Level Classification E-value
Superfamily L domain-like 2.27e-62
Family Internalin LRR domain 0.08
Further Details:      
 
Domain Number 2 Region: 754-860
Classification Level Classification E-value
Superfamily PDZ domain-like 1.04e-25
Family PDZ domain 0.0000507
Further Details:      
 
Domain Number 3 Region: 620-717
Classification Level Classification E-value
Superfamily PDZ domain-like 1.06e-24
Family PDZ domain 0.0000399
Further Details:      
 
Domain Number 4 Region: 903-995
Classification Level Classification E-value
Superfamily PDZ domain-like 7.76e-24
Family PDZ domain 0.0049
Further Details:      
 
Domain Number 5 Region: 996-1093
Classification Level Classification E-value
Superfamily PDZ domain-like 1.71e-23
Family PDZ domain 0.0000135
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) M3Y9T4
Sequence length 1523
Comment (tr|M3Y9T4|M3Y9T4_MUSPF) Scribbled planar cell polarity protein {ECO:0000313|Ensembl:ENSMPUP00000008091} KW=Complete proteome; Reference proteome OX=9669 OS=Mustela putorius furo (European domestic ferret) (Mustela furo). GN=SCRIB OC=Mustelinae; Mustela.
Sequence
MQLVELDVSRNDIPEIPESIKFCKALEIADFSGNPLSRLPEGFTQLRSLAHLALNDVSLQ
ALPGDVGNLANLVTLELRENLLKSLPASLSFLVKLEQLDLGGNELEVLPDTLGALPNLRE
LWLDRNQLSALPPELGNLRRLVCLDVSENRLEELPAELGGLLLLTDLLLSQNLLQRLPDG
IGQLKQLSILKVDQNRLCEVTEAIGDCENLSELVLTENLLTALPRSLGKLTKLTNLNADR
NRLEALPPEIGGCAALSVLSLRDNRLAALPPELAHTAELHVLDVAGNRLRSLPFALTHLN
LKALWLAENQAQPMLRFQTEDDAQTGEKVLTCYLLPQQPPPSLEDPGQQSSPSESRSDVP
PSRVSVIQFLEVPACGDDAEGAAAEKRGLQRRATPHPSELKVLKRGVEERRGEAHSRRPE
SGSPSPLEEDKRLSTESGVSEDSQPSAGTASQGEPEGPSLQEAAPGPQEEAAEESYEEPT
VRFAEDTLLLPPAEDGESEEAPWPLPGGRQRLIRKDTPHYKKHFKISKLPQPEAVVALLQ
GAQPDGEGLGAPSGWHNGPHAPWAPRAEEEEEEEEEEPEEEEEEAVEAEPEEEEEQAATL
VPAPSVKGVSFDPANNLLIEPARIEEEELTLTIVRQTGGLGISIAGGRGSTPYKGGDEGV
FISRVSEEGPAARAGVRVGDKLLEVNGVALHSAEHHQAVEALRGAGSTVRMRLWRERMVE
PENAITVTPLRPEDDYSPREWRGAGLRLPLLQPESAGAPRQRHVACLVRSEKGLGFSIAG
GKGSTPYRAGDGGIFISRIAEGGAAHRAGTLQVGDRVLSINGVDMTEARHDHAVSLLTAA
SPTIALLLEREAGGPLPPSPLPHSPPPPIAATTAVVTATPGESGLLRLAPGLPAAASEGP
YPVEEICLPRAGGPLGLSIVGGSDHSSHPFGIQEPGVFISKVLPRGLAARSGLRVGDRIL
AVNGQDIREATHQEAVSALLRPCLELVLLVRRDPPPPGMRELCIQKAPGEKLGISIRGGA
KGHAGNPCDPTDEGIFISKVSPTGAAGRDGRLRVGLRLLEVNQQSLLGLTHGEAVQLLRG
VGDTLTVLVCDGFDASPTVPAEVSPGVIANPFAAGLGCRNSLESISSIDRELSPEGSAKE
KELPGQTPPWGLEAVGLSSESLKLDYRTLAAVPGAGSVQRVQSGATGGNTTESHCSPSCQ
QPPAPPSPDALPTNVKQAYRTFAAVPGPHPLQDTPTQPPTPGATASPEQLSFRERQKYFE
LEVRVPQAEGPPKRVSLVGADDLRKMQEEEARKLQQKRAQLLREAEEAEAGGLALDLDGE
EQEEPATWASPAAGLSPSSPQPPGGSAPVRTAKAERRQQERLRVQSPELSMQVPDRALSP
AERRALEAEKRALWRAARMKSLEQDALRAQMVLSKSQEGRSRRGPLERLAEAPSPAPTPS
PTPVEDLGPQTSSSPGRLSPDFAEELRSLEPSPSPGLQEEAGEVAVVLLGRPSPATAGPE
EVTLCSSRRPVRPGRRGLGPVPS
Download sequence
Identical sequences M3Y9T4
ENSMPUP00000008091 ENSMPUP00000008091 XP_012904848.1.14098

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]