SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for M3Y9X1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  M3Y9X1
Domain Number 1 Region: 139-254
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 1.14e-23
Family Voltage-gated potassium channels 0.0029
Further Details:      
 
Domain Number 2 Region: 5-31,71-139
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 1.7e-23
Family Voltage-gated potassium channels 0.0038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) M3Y9X1
Sequence length 357
Comment (tr|M3Y9X1|M3Y9X1_MUSPF) Potassium channel subfamily K member {ECO:0000256|PIRNR:PIRNR038061} KW=Complete proteome; Reference proteome OX=9669 OS=Mustela putorius furo (European domestic ferret) (Mustela furo). GN=KCNK3 OC=Mustelinae; Mustela.
Sequence
QNVRTLALIVCTFTYLLVGAAVFDALESEPEMIERQRLELRQQELRARYNLSQGGYEELE
RVVLRLKPHKAGVQWRFAGSFYFAITVITTIGYGHAAPSTDGGKVFCMFYALLGIPLTLV
MFQSLGERINTFVKYLLHRAKRGLGMRRADVSMANMVLIGFFSCISTLCIGAAAFSYYEH
WTFFQAYYYCFITLTTIGFGDYVALQKDQALQTQPQYVAFSFVYILTGLTVIGAFLNLVV
LRFMTMNAEDEKRDAERGFRNVYAEVLHFQSMCSCLWYKSREKLQYSIPMIIPRDLSTSD
TCVEQSHSSPGGGGRYSDTPSHRCLCSGAQRSAISSVSTGLHSLSTFRGLMKRRSSV
Download sequence
Identical sequences M3Y9X1
ENSMPUP00000008128 ENSMPUP00000008128

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]