SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for M3YA73 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  M3YA73
Domain Number 1 Region: 153-254
Classification Level Classification E-value
Superfamily PH domain-like 1.62e-34
Family Phosphotyrosine-binding domain (PTB) 0.00000473
Further Details:      
 
Domain Number 2 Region: 3-128
Classification Level Classification E-value
Superfamily PH domain-like 0.000000000833
Family Pleckstrin-homology domain (PH domain) 0.022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) M3YA73
Sequence length 483
Comment (tr|M3YA73|M3YA73_MUSPF) Docking protein 1 {ECO:0000313|Ensembl:ENSMPUP00000008230} KW=Complete proteome; Reference proteome OX=9669 OS=Mustela putorius furo (European domestic ferret) (Mustela furo). GN=DOK1 OC=Mustelinae; Mustela.
Sequence
MDGAVMEGPLFLQSQRFGTKRWRKTWAVLYPASPHGVARLEFFDHKGSSSGGGRGGSRRL
DCKVIRLAECVSVVPVSVESPPEPGAAAFRLDTAQRSHLLAADAPSSAAWVQTLCRNAFP
KGSWALAPAENPPKLSALEMLENSLYSPTWEGSQFWVTVQRTEAAERCGLQGSYVLRVEA
ERLTLLTMGTQSQILEPLLFWPYTLLRRYGRDKVMFSFEAGRRCPSGPGTFTFQTAQGND
IFQAVETAIHRQKVQGKDGQGQDSLKADSHEGEVAEGKLASLPGPQELLGSPPTVYAEPL
DSLRIPPGPSLDSLYSDPLDSTPAQAGEGVPFKKSLYCDLYEHVQQQLLKAKLMDPKEDP
IYDEPEGLAPAAPRGLYDLPQEPKDAWWCQARMKEEGYELPYNPATDDYAVPPPRSTKPL
PAPKPRGLAFAEPGAAGGGGSKGHSSDTVLYSQVQKSRASGSWDCELSRTGADRMGVKSE
DST
Download sequence
Identical sequences M3YA73
ENSMPUP00000008230 XP_004742314.1.14098 ENSMPUP00000008230

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]