SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for M3YAK2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  M3YAK2
Domain Number 1 Region: 54-116
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 3.79e-26
Family KRAB domain (Kruppel-associated box) 0.001
Further Details:      
 
Domain Number 2 Region: 462-519
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 9.2e-26
Family Classic zinc finger, C2H2 0.0041
Further Details:      
 
Domain Number 3 Region: 518-575
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 6.2e-24
Family Classic zinc finger, C2H2 0.0059
Further Details:      
 
Domain Number 4 Region: 686-743
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 8.5e-24
Family Classic zinc finger, C2H2 0.0047
Further Details:      
 
Domain Number 5 Region: 406-463
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.12e-23
Family Classic zinc finger, C2H2 0.0068
Further Details:      
 
Domain Number 6 Region: 574-629
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.12e-22
Family Classic zinc finger, C2H2 0.0057
Further Details:      
 
Domain Number 7 Region: 632-687
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.61e-22
Family Classic zinc finger, C2H2 0.0043
Further Details:      
 
Domain Number 8 Region: 728-780
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.08e-17
Family Classic zinc finger, C2H2 0.0054
Further Details:      
 
Domain Number 9 Region: 368-420
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000015
Family Classic zinc finger, C2H2 0.0078
Further Details:      
 
Domain Number 10 Region: 283-343
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000617
Family Classic zinc finger, C2H2 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) M3YAK2
Sequence length 789
Comment (tr|M3YAK2|M3YAK2_MUSPF) Zinc finger protein 606 {ECO:0000313|Ensembl:ENSMPUP00000008359} KW=Complete proteome; Reference proteome OX=9669 OS=Mustela putorius furo (European domestic ferret) (Mustela furo). GN=ZNF606 OC=Mustelinae; Mustela.
Sequence
MAAINPWASWGVLTDQSWGIAAVDPWASWALCPQDCHVEENAKEERRATGFPTAQIQEPV
TFKDVAVDFTQEEWGQLDSVQRTLYRDVMLETYGHLLSVGNHIAKPEVISLLEQGEEPWS
VEQAYPQSTCPEWMRNLERKALIPTQSVLEEEQSHSMKLERYIWDDPLFSRLEVLGCKDQ
LEMYHMNQSTAMRQMVFMQKQVLSQRGSEFCELGAEYSQNLNFVPSQRVSQIEHFYKPGT
NAESWRCNSAIMYADKITCGNLDYDKACHQSIQPIQPEKIQTGDNLLKCPDAVKSFNHIL
HFGDRKGMHTGEKLYEYKECHQIFNQSPSYNEHPQLHIGENQYDYKEYENIFYFSSFMEH
PKIGTVEKAYKYNEWEKVFGYDSFLTQHTSTYTSEKPYEYNECGTSFIWSSYLIQHKKTH
TGEKPYECDKCGKVFRNRSALTKHERTHTGIKPYECNKCGKAFSWNSHLIVHKRIHTGEK
PYVCNECGKSFNWNSHLIGHQRTHTGEKPFECTECGKSFSWSSHLIAHMRMHTGEKPFKC
DECEKAFRDYSALSKHERTHSGAKPYKCTECGKSFSWSSHLIAHQRTHTGEKPYNCQECG
KAFRERSALTKHEIIHSGIKPYECNKCGKSCSQMAHLVRHQRTHTGEKPYECNKCGKSFS
QSCHLVAHRRIHTGEKPYKCNQCERSFNCSSHLIAHRRTHTGEKPYRCNECGKAFNESSS
LIVHLRNHTGEKPYKCNHCEKAFCKNSSLIIHQRMHSGEKRFICSDCGKAFSGHSALLQH
QRNHSEEKL
Download sequence
Identical sequences M3YAK2
ENSMPUP00000008359 XP_004780545.1.14098 XP_004780546.1.14098 ENSMPUP00000008359

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]