SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for M3YAL7 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  M3YAL7
Domain Number 1 Region: 674-736,768-917
Classification Level Classification E-value
Superfamily RNI-like 2.22e-32
Family 28-residue LRR 0.00066
Further Details:      
 
Domain Number 2 Region: 72-156
Classification Level Classification E-value
Superfamily DEATH domain 3.77e-21
Family Pyrin domain, PYD 0.0047
Further Details:      
 
Domain Number 3 Region: 236-424
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.000000000712
Family Extended AAA-ATPase domain 0.077
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) M3YAL7
Sequence length 948
Comment (tr|M3YAL7|M3YAL7_MUSPF) NLR family pyrin domain containing 6 {ECO:0000313|Ensembl:ENSMPUP00000008374} KW=Complete proteome; Reference proteome OX=9669 OS=Mustela putorius furo (European domestic ferret) (Mustela furo). GN=NLRP6 OC=Mustelinae; Mustela.
Sequence
RRQSLGAKPRSPLHASPPRECSLEQRGLVGAADRRAPRGRVGWEAGQGRGPRNHMRVDRH
RPPAPSTEARAAKARDLLQAALEDLSQEQLKRFRHKLRDAALDGRSIPWGRLERADAVDL
AEQMIQFYGPEPALDVARKTLKRADVRDVAARLKEQGLQWFSPGSSALLSVSEYKKKYRE
HVLQQHAKVKERNARSVKINKRFTKLLIARESAALVDEAPGLAEEPEPERARRSDTHTFN
RLFGRDEEGQRPLTVVLQGPAGIGKTMAAKKILYDWAVGKLYHDQVDFAFFLPCRELLER
PGPCSLARLVLDQCPHRSAPVRQMLARSERLLFILDGADELPPGPADAAPCTDPFEEADG
ARVLDGLMSKTLLPGARLLVTARATAPGRLQGRLCSPQCAEVRGFSDKDKKKYFHKFFRD
ERMAERAYRFVKENETLFALCFVPFVCWIVCTVLRQQLQLHQDLSRTSKTTTSVYLLFIT
SVLSSAPATDGPQMQEELRKLGRLAREGTLRHRAQFPEKDLERLELRGSKVQTLFLSKKE
LPGVLETEVTYQFMDQSFQEFFAALSYLLEQEKALEAPADSVGALLQGGTELRGHLTLTT
RFLFGLLNGERLRDIERHFGCGGVVSKRVKQDVLRWVQEQGQGHPRAAPEGTEETEAPEG
SQEPEEEEEGELSYPLELLYCLYETQESTFVHQALRGWPELLLERVHFSRLDLLVLSYCV
RSCPAGQALRLVSCVLVPPQEKKKKSLIKRLHGSLSGSSSQATARKSQASPLRTLFEAMT
DQHCGLHSLTLCRCRLPDSICRDLSEALREAPALRELGLLHNRLSEAGLRVLSEGLAWPQ
CRVQKLRVWQPRLQEAFQYLTSVLRQSPALTILELGDCQLSEPTVTDLCAVLQHPGCRLQ
TLRLTSVQLSEQSLKELQVVKTAKPDLVITHPALDGHPRPPAGHSSAL
Download sequence
Identical sequences M3YAL7
ENSMPUP00000008374 ENSMPUP00000008374

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]