SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for M3YB94 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  M3YB94
Domain Number 1 Region: 100-194
Classification Level Classification E-value
Superfamily PDZ domain-like 7.62e-21
Family PDZ domain 0.0000313
Further Details:      
 
Domain Number 2 Region: 197-237
Classification Level Classification E-value
Superfamily PDZ domain-like 0.0000985
Family PDZ domain 0.00048
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) M3YB94
Sequence length 239
Comment (tr|M3YB94|M3YB94_MUSPF) Uncharacterized protein {ECO:0000313|Ensembl:ENSMPUP00000008601} KW=Complete proteome; Reference proteome OX=9669 OS=Mustela putorius furo (European domestic ferret) (Mustela furo). GN= OC=Mustelinae; Mustela.
Sequence
MSLYPSLEDLKVDKVIQAQTAFSANPGNLEILSEASAPISQDGNLYPKLYPELSQYMGLS
LNEEQIRANMAVVPGAPVQGQLVARPSSMNYMVAPVTGNDVGIRRAEIKQGIREVILCKD
QDGKIGLRLKSIDNGIFVQLVQANSPASLVGLRFGDQVLQINGENCAGWSSDKAHKVLKQ
AFGEKITMTVHDRPFERTVTKHKDSTGHVGFIFKNGKITSIVKDSSAARNGLLTEHNIC
Download sequence
Identical sequences M3YB94
ENSMPUP00000008601 ENSMPUP00000008601 XP_012909455.1.14098

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]