SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for M3YBF6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  M3YBF6
Domain Number 1 Region: 342-514
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 8.71e-60
Family SPRY domain 0.0000102
Further Details:      
 
Domain Number 2 Region: 58-144
Classification Level Classification E-value
Superfamily RING/U-box 2.43e-20
Family RING finger domain, C3HC4 0.015
Further Details:      
 
Domain Number 3 Region: 146-205
Classification Level Classification E-value
Superfamily B-box zinc-binding domain 0.0000000000000153
Family B-box zinc-binding domain 0.0015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) M3YBF6
Sequence length 522
Comment (tr|M3YBF6|M3YBF6_MUSPF) Tripartite motif containing 38 {ECO:0000313|Ensembl:ENSMPUP00000008663} KW=Complete proteome; Reference proteome OX=9669 OS=Mustela putorius furo (European domestic ferret) (Mustela furo). GN=TRIM38 OC=Mustelinae; Mustela.
Sequence
MPQGLILGLRLCAGCLGRSYVLCWAQGLPPPHVPAGHDEPLGCRAAQVSIPYWNLSGKAM
ASATKKMKEEATCAICLSLMSEPVSISCGHSYCNQCIMSFLENQGPVDTSSNTFPCPHCR
APFRLASLRPNKQLGSLIEAIKEMEHEMSCEEHGEHLHLFCEDESQLICWRCERSPRHKG
HHTALIEDVCQDYKEKLQNAVTNLRQLEEECTKLKLFTTKQISEWNEKIDIEKQKIQSDF
KNLQSFLQEEEKSHLWRLEKEKEQTLKRLRDNEATLEQKSQELRSHILELEEKCQSSAQK
LLQDVKDTLRRSWAMTLERPDAHSLELHAVCSVSELYFDVKKMLRSYQVNVTLDPDTAHR
ELILSEDRRQVTRGCPQENLDNSSKRFSILPCILGCEGFISGKHYFEVDVGEGTGWDLGV
CLDSVHRDVGLMQKPQSGFWAIRLCKKKGYLALTCPITSLSLVEQPLVVGIFLDCDVGLV
SFYNMTTGSHIFTFPKASFSDTVRPYFRVYQHSPLFLPPPDE
Download sequence
Identical sequences M3YBF6
XP_004778815.1.14098 ENSMPUP00000008663 ENSMPUP00000008663

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]