SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for M3YBH2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  M3YBH2
Domain Number 1 Region: 6-91
Classification Level Classification E-value
Superfamily PDZ domain-like 1.45e-20
Family PDZ domain 0.0000454
Further Details:      
 
Domain Number 2 Region: 617-681
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 1.87e-18
Family LIM domain 0.0095
Further Details:      
 
Domain Number 3 Region: 558-621
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 5.16e-18
Family LIM domain 0.01
Further Details:      
 
Domain Number 4 Region: 526-556
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.00000158
Family LIM domain 0.0016
Further Details:      
 
Domain Number 5 Region: 677-701
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.0000212
Family LIM domain 0.026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) M3YBH2
Sequence length 708
Comment (tr|M3YBH2|M3YBH2_MUSPF) LIM domain binding 3 {ECO:0000313|Ensembl:ENSMPUP00000008679} KW=Complete proteome; Reference proteome OX=9669 OS=Mustela putorius furo (European domestic ferret) (Mustela furo). GN=LDB3 OC=Mustelinae; Mustela.
Sequence
MSYSVTLTGPGPWGFRLQGGKDFNMPLTISRITPGSKAAQSQLSQGDLVVAIDGVNTDTM
THLEAQNKIKSASYNLSLTLQKSKRPIPISTTAPPVQSPLPVIPHQKDPARDTNGSPAAL
SPNPEARASLGTPGTPELRHTFSSFSQTSVFSSHTEASEPGPPRGSPGAKTSLEGALDSF
SPKAPQGSSQPRQYNNPIGLYSAETLREMAQMYQMSLRGKASGAGLPGGSLPIKDLAVDS
ASPVYQAVIKNQNKPEDEADEWARRSSNLQSRSFRILAQMTGTEYMQDPDEEALRRSSTP
IAHAPVCTSQAATPLLPASAQPPAAAPPGAASPPLSAATAHAATASAAAPASSPADSPRP
QASAYSPAKATSPAPATHTYNEASAAPAPKPRVVTTASIRPSVYQPVPVSTYSPSPGGNY
SPAPYTPSPAPTYSPSPAPSYTPSPAPSYNPAPSAAAYSGGPVESASRPPWVSDDSFSQK
FAPGKSTTSISKQTLPRGTPAYTPVGPQVSPLARGIVQRAERFPASSRTPLCGHCNNVIR
GPFLVAMGRSWHPEEFNCAYCKTSLADVCFVEEQNNVYCERCYEQFFAPICAKCNTKIMG
EVMHALKQTWHTTCFVCAACKKPFGNSLFHMEDGEPYCEKDYVNLFSTKCHGCDFPVEAG
DKFIEALGHTWHDTCFICAVCHVNLEGQPFYSKKDRPLCKKHAHAINV
Download sequence
Identical sequences M3YBH2
XP_004765841.1.14098 ENSMPUP00000008679 ENSMPUP00000008679

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]