SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for M3YBU7 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  M3YBU7
Domain Number 1 Region: 318-396
Classification Level Classification E-value
Superfamily Intermediate filament protein, coiled coil region 1.17e-23
Family Intermediate filament protein, coiled coil region 0.0000326
Further Details:      
 
Domain Number 2 Region: 92-128
Classification Level Classification E-value
Superfamily Intermediate filament protein, coiled coil region 0.000000000000356
Family Intermediate filament protein, coiled coil region 0.00066
Further Details:      
 
Weak hits

Sequence:  M3YBU7
Domain Number - Region: 138-235
Classification Level Classification E-value
Superfamily Myosin rod fragments 0.0068
Family Myosin rod fragments 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) M3YBU7
Sequence length 457
Comment (tr|M3YBU7|M3YBU7_MUSPF) Glial fibrillary acidic protein {ECO:0000313|Ensembl:ENSMPUP00000008804} KW=Complete proteome; Reference proteome OX=9669 OS=Mustela putorius furo (European domestic ferret) (Mustela furo). GN=GFAP OC=Mustelinae; Mustela.
Sequence
LGSARPAHASIKPSLPRSGQSPASMERRRVASAARRSYASSLDMVGGSLVSGRRLGPGTR
LSLARMPLPLPARVDFSLAGALNTGFKETRASERAEMMELNDRFASYIEKVRFLEQQNKA
LAAELNQLRAKEPTKLADVYQAELRELRLRLDQLTASSARLEVERDNLAQDLGTLRQKLQ
DETNLRLDAENNLATYRQEADEATLARLDLERKIESLEEEIRFLRKIHEEEVQELQEQLA
RQQVHVELDVAKPDLTAALREIRTQYEAMASSNMHEAEEWYRSKFADLNDAAARNAELLR
QAKHEANDYRRQLQALTCDLESLRGTNESLERQMREQEERHAREAASYQEALARLEEEGQ
SLKDEMARHLQEYQDLLNIKLALDIEIATYRKLLEGEENRITIPVQTFSNLQIRETSLDT
KSVSEGHLKRNIVVKTVEMRDGEQVIKESKQEHKDVM
Download sequence
Identical sequences M3YBU7
ENSMPUP00000008804 ENSMPUP00000008804

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]