SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for M3YC48 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  M3YC48
Domain Number 1 Region: 447-588
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 7.6e-22
Family MAM domain 0.001
Further Details:      
 
Domain Number 2 Region: 120-235
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000000000004
Family Growth factor receptor domain 0.012
Further Details:      
 
Domain Number 3 Region: 243-292
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000175
Family EGF-type module 0.017
Further Details:      
 
Weak hits

Sequence:  M3YC48
Domain Number - Region: 53-91
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0335
Family EGF-type module 0.028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) M3YC48
Sequence length 597
Comment (tr|M3YC48|M3YC48_MUSPF) Nephronectin {ECO:0000313|Ensembl:ENSMPUP00000008905} KW=Complete proteome; Reference proteome OX=9669 OS=Mustela putorius furo (European domestic ferret) (Mustela furo). GN=NPNT OC=Mustelinae; Mustela.
Sequence
MDFLLALVLGSSLYLQAAAEFDVRWPRQIVSSVGLCRYGGRIDCCWGWARRSWGQCQPVC
QPQCKHGECIGPDKCKCHPGYAGKTCNQDEHLYPTPLDQGSEQPLFQPLDHQATSLPSRD
LNECGLKPRPCKHRCMNTYGSYKCYCLNGYMLMPDGSCSSALTCSMANCQYGCDVVKGQI
RCQCPSPGLQLAPDGRTCVDVDECVTGRASCPRFRQCVNTFGSYVCKCHKGFDLMYIGGK
YQCHDIDECSLGQYQCSRFARCYNVHGSYKCKCKDGYEGDGLNCVYIPKVMIEPSGPIHV
PKGNGTISKGDGGHSNWIPDVGGTRWPPKTPYIPPVITNRPTSKPTTRPAPRPTPEPTPP
PFPELGTSPPATSSESTGTQLTPVVPVVTTSPRWITVDNRIQTDPQKPRGDVFIPRQPSN
DLFEIFEIERGVSADDEAKDDPGVLIHSCNFDHGLCGWIREKDSDLHWEPVRDPAGGQYL
TVSGAKGPGGKAARLVLPLGHLMHSGDLCLSFRHKVTGLHSGALQVFVRKHGAHGAALWG
RNGGRGWRHTHITLRGADVKSVIFRGEKRRGHTGEIGLDDVSLRKGHCSEERQRLPN
Download sequence
Identical sequences M3YC48
ENSMPUP00000008905 XP_004748189.1.14098 ENSMPUP00000008905

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]