SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for M3YC77 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  M3YC77
Domain Number 1 Region: 767-973
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 3.34e-50
Family BCR-homology GTPase activation domain (BH-domain) 0.0000808
Further Details:      
 
Domain Number 2 Region: 280-559
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 9.77e-46
Family FCH domain 0.016
Further Details:      
 
Domain Number 3 Region: 695-747
Classification Level Classification E-value
Superfamily Cysteine-rich domain 0.00000000152
Family Protein kinase cysteine-rich domain (cys2, phorbol-binding domain) 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) M3YC77
Sequence length 1121
Comment (tr|M3YC77|M3YC77_MUSPF) Rho GTPase activating protein 45 {ECO:0000313|Ensembl:ENSMPUP00000008934} KW=Complete proteome; Reference proteome OX=9669 OS=Mustela putorius furo (European domestic ferret) (Mustela furo). GN=ARHGAP45 OC=Mustelinae; Mustela.
Sequence
MFSRKKRELMKTPSISKKNRAGSPSPQPLGELPRKDGPDTVSLGPSLEPPSTASNAKATG
TLKRPTSLSRHASAAGFPLPGASSWTLGRGHRSPLAAAGPAEPPVEGPCPDTGEISHLLA
DVGRFAKALEKLKECVLRDDLLEARRPLAHEYLGDALRVMRQIISRYPLLNTVESLTAAG
TLIAKIRAFHYESNQECDKQEFEKALETIALSFSNTVSEFLMGEVDSSTLLSVPPGDPIQ
TMENLYGPGSEGTAPSADDCEAGCLAPEEVDMLLQRCEGGVDAALHYAKNMAKYMKDLIG
YVEKRTALEMDFAKGVQKIVHNCRQSFMQQPHMPLLSIYSLALEQDLEFGHSMTQAVGTL
QSQTLTQPLNLRRLEHEKRRKEIKELWHRAQRKLQEAESNLRKAKQGYTQRCEDHGKAHF
LAVKAEEEQAVTGPGAAASKTLDKRRRLEEEAKNKAEEAMATYRTCVADAKTQKQELEDT
KVTVLRQIQEVIRQSDQTIKSATISYYQMLHMQTASLPVHFQMLCESSKLYDPGQQYASY
VSQLQRDEEPDVRYDFEPHVSANAWSPVMRTRKGSLASDATGAEATGSPEEEGGSGNGTP
AKEHRGGRGHQVHKSWPTTVSDSEGSLDPSPGSGDFKKLERMSSSGTLSSNEELVDQEGS
AGPSAFEQADLNGMAPELPVAVPSGPFRNVGLSKAARTHRLRKLRTPAKCRECNSYVYFQ
GAECEECCLACHKKCLDTLAIQCGHKKLQGRLQLFGQDFLKAACGAPDGIPFIVKKCVCE
IEQRALHTKGIYRLNGVKTRVEKLCQAFEAGQELVELSQASPHDISNVLKLYLRQLPEPI
LSFRLYHELVGLAKDSLKAEAEAKVASRGRADPAETEAAAVAMAGRLRELLQDLPPENRA
TLTYLLRHLRRIVAVEQDNKMTPGNLGIVFGPTLLRPRPTEATVSLSSLVDYPHQARIVE
TLITHYGLIFEEEPEEDSSDAARAEAEVQVPYQEGSAGATVPLQEVADGGPESRVASNDS
DSEVEEASELLSPADRGHRLSFQEKQGSEASTEVAQGSRSGSEEQLGAGARHSDGGGLSQ
QLAEFNANQCNNVAKVPLPAMGLRGARLEAGTGPGRQPECV
Download sequence
Identical sequences M3YC77
ENSMPUP00000008934 ENSMPUP00000008934

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]