SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for M3YCD3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  M3YCD3
Domain Number 1 Region: 626-925
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 2.6e-83
Family Protein kinases, catalytic subunit 0.000000000718
Further Details:      
 
Domain Number 2 Region: 32-204
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 4.25e-74
Family Ephrin receptor ligand binding domain 0.000000906
Further Details:      
 
Domain Number 3 Region: 331-537
Classification Level Classification E-value
Superfamily Fibronectin type III 2.83e-42
Family Fibronectin type III 0.0000739
Further Details:      
 
Domain Number 4 Region: 920-995
Classification Level Classification E-value
Superfamily SAM/Pointed domain 2.95e-22
Family SAM (sterile alpha motif) domain 0.00027
Further Details:      
 
Domain Number 5 Region: 260-322
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000115
Family Growth factor receptor domain 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) M3YCD3
Sequence length 998
Comment (tr|M3YCD3|M3YCD3_MUSPF) EPH receptor A7 {ECO:0000313|Ensembl:ENSMPUP00000008990} KW=Complete proteome; Reference proteome OX=9669 OS=Mustela putorius furo (European domestic ferret) (Mustela furo). GN=EPHA7 OC=Mustelinae; Mustela.
Sequence
MVFQTRHPSWIILCYIWLLRFAHTGEAQAAKEVLLLDSKAQQTELEWISSPPNGWEEISG
LDENYTPIRTYQVCQVMEPNQNNWLRTNWISKGNAQRIFVELKFTLRDCNSLPGVLGTCK
ETFNLYYYETDYDTGRNIRENLYVKIDTIAADESFTQGDLGERKMKLNTEVREIGPLSKK
GFYLAFQDVGACIALVSVKVYYKKCWSIIENLAIFPDTVTGSEFSSLVEVRGTCVSSAEE
EAENSPRMHCSAEGEWLVPIGKCICKAGYQQKGDTCEPCGRGFYKSSSQDLQCSRCPTHS
FSDKEGSSRCECEDGYYRAPSDPPYVACTRPPSAPQNLIFNINQTTVSLEWSPPADNGGR
NDVTYRILCKRCSWEQGECVPCGSNIGYMPQQTGLEDNYVTVMDLLAHANYTFEVEAVNG
VSDLSRSQRLFAAVSITTGQAAPSQVSGVMKERVLQRSVELSWQEPEHPNGVITEYEIKY
YEKDQRERTYSTVKTKSTSASINNLKPGTVYVFQIRAFTAAGYGNYSPRLDVATLEEATG
KMFEATAVSSEQNPVIIIAVVAVAGTIILVFMVFGFIIGRRHCGYSKADQEGDEELYFHF
KFPGTKTYIDPETYEDPNRAVHQFAKELDASCIKIERVIGAGEFGEVCSGRLKLPGKRDV
AVAIKTLKVGYTEKQRRDFLCEASIMGQFDHPNVVHLEGVVTRGKPVMIVIEFMENGALD
AFLRKHDGQFTVIQLVGMLRGIAAGMRYLADMGYVHRDLAARNILVNSNLVCKVSDFGLS
RVIEDDPEAVYTTTGGKIPVRWTAPEAIQYRKFTSASDVWSYGIVMWEVMSYGERPYWDM
SNQDVIKAIEEGYRLPAPMDCPAGLHQLMLDCWQKERAERPKFEQIVGILDKMIRNPNSL
KTPLGTCSRPISPLLDQNTPDFTTFCSVGEWLQAIKMERYKDNFTAAGYNSLESVARMTI
EDVMSLGITLVGHQKKIMSSVQTMRAQMLHLHGTGIQV
Download sequence
Identical sequences M3YCD3
ENSMPUP00000008990 ENSMPUP00000008990 XP_004766944.1.14098

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]