SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for M3YCN4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  M3YCN4
Domain Number 1 Region: 252-776
Classification Level Classification E-value
Superfamily FabD/lysophospholipase-like 2.38e-145
Family Lysophospholipase 0.000000428
Further Details:      
 
Domain Number 2 Region: 6-129
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 2.98e-28
Family Synaptotagmin-like (S variant) 0.094
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) M3YCN4
Sequence length 783
Comment (tr|M3YCN4|M3YCN4_MUSPF) Phospholipase A2 {ECO:0000256|RuleBase:RU362102} KW=Complete proteome; Reference proteome OX=9669 OS=Mustela putorius furo (European domestic ferret) (Mustela furo). GN= OC=Mustelinae; Mustela.
Sequence
MALAKIPGTCLLTVRVLQARGLPSKDLVTPSDCYVSLWLPTASSHRLQTRTVKNSRNPIW
NQSFRFRIHSQLKNVLQLQVFDQDLLTSDDPMLSVLFDLGTLQAGDFRRESFSLNPQGEE
RLEVEFRLQRLTDCAEQLVSNGILVARELSCLHVRLEEAGDQKQSEGRVQLVVPGSCEGQ
QEASVGAGPVCFHCPACWEQELGILLQGAPREQLKVPLSALPSGQVVRLVFPTSQEPLMR
VELRKEGPKELAVRLGCGPCAEEQAFLSRRKQLVARALKQVLQLDDDLQEDEVPVVAVMA
TGGGIRAMLSLYGQLAGLRELGLLDCVSYITGASGSTWALTNLYEDPEWSQKDLAGPTES
LKTQVTKSKLGVLAPSQLQRYRQELAERARLGHPPCFTNLWALISEGLLHEEPRDCTLSD
QREALSRGQNPLPIYCALNTKEKGLTTFEFGEWCEFSPYEVGFPKYGAFIPSELFGSEFF
MGRLTKRLPESRICFLEGIWSNLYAANLQDSLYWASEPSQFWDRWAQDQASRDKEQVPLL
KIEEPPTGAGRIAEFFTDLLTRRPLAQATHNFLRGLHFHKDYFHDPYFSTWKATKLDGFP
NQLTPAEPHLCLLDVGYLINTSFPPLLRPTRDVDLVLSLDYNLEGAFQQLQLLGRLCGEQ
GIPFPPISPSPEEQCQPRECHLFLDPDCPDAPAVLHFPLVDDSFREYSAPGIPRTPTEKA
AGEVNLSPSDSPYHYSKLTYSLEDADKLLRLTHYNICNNREQLLEALRGAVLRRRQRQHH
QPQ
Download sequence
Identical sequences M3YCN4
XP_004751227.1.14098 ENSMPUP00000009091 ENSMPUP00000009091

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]