SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for M3YD02 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  M3YD02
Domain Number 1 Region: 162-226
Classification Level Classification E-value
Superfamily SH3-domain 1.58e-18
Family SH3-domain 0.00098
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) M3YD02
Sequence length 689
Comment (tr|M3YD02|M3YD02_MUSPF) Nephrocystin 1 {ECO:0000313|Ensembl:ENSMPUP00000009209} KW=Complete proteome; Reference proteome OX=9669 OS=Mustela putorius furo (European domestic ferret) (Mustela furo). GN=NPHP1 OC=Mustelinae; Mustela.
Sequence
MLARRHRHPLQALQRRSQELKLQVDSLLSESRLKGVLDSSKRRDIYQRCVQLKQAIDENK
NALQKLNKADEPAPVGNYNQKKEEEHNLLDKLTHQLQELAVSISRENITEIKTPSEREED
DDSADEDEEAEKEEEDDEEEESEGSGGEEEETEEEEKQENESHSQTSKEYIAVGDFAAQQ
AGDLTFKKGEILLIIEKKPDGWWIAKNAKGNKGLIPRTYVEPYNKEGGQDSSEEGSEEDV
EVEDQTAEGEEVKQRTDSHWSAVRKAISEQINTVDVLTTMGAIPAGFRPSTLFQLLEEGN
QFRASYFLQPELTPSQLAFRDLMWDAKTGTIRSRPSRVSFILTLWSCKMIPLPGMSIQVL
SRHVRLCLFDGNKVLSNIHTVRATWLPKKPKTWTFSPQVTGILPCLLDGDCFIRSNSSSP
DLGILFELGISYIRNSTGERGELSCGWVFLKLFDASGIPIPAKTYELFLNGGTPYEKGVE
VDPSISRRAHGSVFHQMMTMRRQPQLLVKLRSLNRRSRDLLSLLPETLIGSMCSIHLLIF
YRQILGDVLLKDRMTMQSADLISNPVLATFPKLLEQPDIMDALRSSWAEKESTLKRSEKR
DREFLKATFLLVYHDCVIPLLHSTLLPPFRWAEEETEAARWKVITDFLKQNQENEGALQA
LLSPDGVHEPFDISEQTYDFLGEIRKNAA
Download sequence
Identical sequences M3YD02
XP_004771017.1.14098 XP_012900465.1.14098 ENSMPUP00000009209 ENSMPUP00000009209

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]