SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for M3YDE7 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  M3YDE7
Domain Number 1 Region: 41-158
Classification Level Classification E-value
Superfamily BRCT domain 3.66e-27
Family 53BP1 0.08
Further Details:      
 
Domain Number 2 Region: 1046-1165
Classification Level Classification E-value
Superfamily BRCT domain 8.37e-24
Family BRCT domain 0.077
Further Details:      
 
Domain Number 3 Region: 863-978
Classification Level Classification E-value
Superfamily BRCT domain 1.02e-20
Family DNA ligase 0.013
Further Details:      
 
Domain Number 4 Region: 807-902
Classification Level Classification E-value
Superfamily BRCT domain 0.0000000000000222
Family DNA-repair protein XRCC1 0.07
Further Details:      
 
Domain Number 5 Region: 2-69
Classification Level Classification E-value
Superfamily BRCT domain 0.000001
Family BRCT domain 0.07
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) M3YDE7
Sequence length 1293
Comment (tr|M3YDE7|M3YDE7_MUSPF) PAX interacting protein 1 {ECO:0000313|Ensembl:ENSMPUP00000009354} KW=Complete proteome; Reference proteome OX=9669 OS=Mustela putorius furo (European domestic ferret) (Mustela furo). GN=PAXIP1 OC=Mustelinae; Mustela.
Sequence
KVIQLLKAGKAKEVSYNALASHIISEDGDNPEVGEAREVFDLPVVKPSWVILSVQCGALL
PVNGFSPESCQIFFGITACLSQVSSDDRSALWALLTFYGGGCQLQLNKKCTHLVVPEPKG
EKYECALKRASIKIVTPDWVLDCISEKTKKDEAFYHPRLIIYEEEEEEEEEEEEEENEEQ
ESPNEGSSEGKSSPASSQEGSPSGDQQFSPKSNTEKSKGELMFDDSSDSSPEKQERNLNW
TPAEVPQLAAAKRRLPSGKEPGLINLCANVPPVPGNILPPEVRGSLLAPGQNLQSSDRSE
MIATWSPAVRTLRNITNNADLQQMSRPSNVAHVSHSLTRASGSLAWDIRKSEEDGDRGGA
FGGLAPHARTSLPRRTLSDSRGPGVLHASGHSVCNLQCGQVWDLAAKKILRGSRVLSQRQ
IRRVRSRLRSTGDVLRVPSLAGLPGAQLSRPVPSHSGRCSCSDARGLPAALCSQPGFPQL
LSSCSPQGRCPGPPGLLRSPAGHCETSPVYLRVPSESKKIQVQTSETPLASKAVNKVKFL
EFYLNVKVVQRPAVQFLGISWLPVPSAPTPELAQSAVLTPVTVRQKEPEQKQSGVEKRHA
VRSRSVQLSGLPVPILQSLSAPTKTLEQQCRSRRSRRPRPPRPPRRSRRPRPRRTRCCTF
PPSSSCSSSHSPRSPSSRPRSRPLYSSPPQPLPFPQQQLHRPQQPLQPQPQHVLQQQLHQ
LQQHQLQQQQLHQLQQQLQLQRLQQQPAPLPHAPGQPAQAAQHPAQPPHQPPQQHQPPPP
QPPPPSQQPQHQLFGHDPAVEIPEEGFLLGCVFAIADYPEQMSDKQLLATWKRIIQTHGG
AVDPTFSSRCTHLLCESQVSGMYAQAIRERKRCVTAHWLNMVLKKKKLVPPHRALHFPVA
FPPGGKPCSQHIISVTGFVDSDRDDLKLMAYLAGAKYTGYLCRGNTVLICKEPTGLKYEK
AKEWRIPCVNAQWLGDILLGNFEALRQVHYGRYTAFNLQEPFAPTPHLVFNLLDAWRVPL
KVSAELLMGVRLPPKPKVSDVTAQPSSKRARIEDIPPPTKKLTPELTPFVLFTGFEPVQV
QQYIKKLYILGGEVAESAQKCTHLIASKVTRTVKFLTAISVVRHIVTPEWLEECFKCQKF
IDEQNYVLRDAEAEVLFSFSLEESLKRAHASPLFKAKYFYITPGICPSLSTMKAIVECAG
GRVLSKQPSFRKLVEHKQNKSLSEIILISCENDLHLCREYFARGIDVHNAEFVLTGVLTQ
TLDYESYPLASSSLRARSRVYSAYAPDSGTEST
Download sequence
Identical sequences M3YDE7
ENSMPUP00000009354 ENSMPUP00000009354

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]