SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for M3YDT0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  M3YDT0
Domain Number - Region: 99-195
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 0.0883
Family DBL homology domain (DH-domain) 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) M3YDT0
Sequence length 338
Comment (tr|M3YDT0|M3YDT0_MUSPF) Uncharacterized protein {ECO:0000313|Ensembl:ENSMPUP00000009487} KW=Complete proteome; Reference proteome OX=9669 OS=Mustela putorius furo (European domestic ferret) (Mustela furo). GN= OC=Mustelinae; Mustela.
Sequence
MDETLVEFIKRTIMKIPITEMMPILKAWDFLSEKQLQTVNFRQRKESLVQDLVLLCEERR
ASIHDAALLDIIYTQFHRHQKVWDVFQMSKEPGEDIDLFDMEQFKSSFVKILQRALKNVT
VSFRDAEENAVWIRIAWGTQYRKPNQYKPVYVVYYSQTPYAFTSFCPLKSNMPLLGQALT
VASNHHKIVKMDLRSRYLDSLKAIVFKQYNRTFETHNSTVPLQDRTLELDIHMDSRIIHE
NRIEKERVQRVTQETFGDYPQPRLEFAQYKLETKFKSELNGDILAERKEPLRCLIKFSSP
HLLEALKALAPAGLAGQAGLSGNTQSPCVRRAATPSLV
Download sequence
Identical sequences M3YDT0
ENSMPUP00000009487 ENSMPUP00000009487

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]