SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for M3YDY2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  M3YDY2
Domain Number 1 Region: 378-581
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 7.42e-54
Family Nucleotide and nucleoside kinases 0.0000134
Further Details:      
 
Domain Number 2 Region: 259-368
Classification Level Classification E-value
Superfamily SH3-domain 3.28e-29
Family SH3-domain 0.0015
Further Details:      
 
Domain Number 3 Region: 117-220
Classification Level Classification E-value
Superfamily PDZ domain-like 1.58e-16
Family PDZ domain 0.001
Further Details:      
 
Domain Number 4 Region: 65-118
Classification Level Classification E-value
Superfamily L27 domain 0.000000000000188
Family L27 domain 0.0016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) M3YDY2
Sequence length 585
Comment (tr|M3YDY2|M3YDY2_MUSPF) Membrane palmitoylated protein 2 {ECO:0000313|Ensembl:ENSMPUP00000009539} KW=Complete proteome; Reference proteome OX=9669 OS=Mustela putorius furo (European domestic ferret) (Mustela furo). GN=MPP2 OC=Mustelinae; Mustela.
Sequence
MPVAATNSESAMQQVLDNLGSLPNATGAAELDLIFLRGIMESPIVRSLAKAHERLEETKL
EAVRDNNLELVQEILRDLAQLAEQSSTAAELARILQEPHFQSLLETHDSVASKTYETPPP
SPGLDPTFSNQPVPPDAVRMVGIRKTAGEHLGVTFRVEGGELVIARILHGGMVAQQGLLH
VGDIIKEVNGQPVGSDPRALQELLRSASGSVILKILPSYQEPHLPRQMQREAGPREVAGW
VWGASCLERDGAQASCIFVKVFVKCHFDYDPGRDSLIPCKEAGLRFSAGDLLQIVNQDDA
NWWQACHVEGGSAGLIPSQLLEEKRKAFVKRDLELTPTSGTLCGSLSGKKKKRMMYLTTK
NAEFDRHELLIYEEVARMPPFRRKTLVLIGAQGVGRRSLKNKLIMWDPDRYGTTVPYTSR
RPKDSEREGQGYSFVSRGEMEADIRAGRYLEHGEYEGNLYGTRIDSIRGVVASGKVCVLD
VNPQAVKVLRTAEFVPYVVFIEAPDFETLRAMNRAALESGVSTKQLTEADLRRTVEESSR
IQRGYGHYFDLSLVNTNLERTFRELQAAMEKLRTEPQWVPVSWVY
Download sequence
Identical sequences M3YDY2
ENSMPUP00000009539 ENSMPUP00000009539

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]