SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for M3YE43 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  M3YE43
Domain Number 1 Region: 779-887
Classification Level Classification E-value
Superfamily Bromodomain 9.16e-34
Family Bromodomain 0.00084
Further Details:      
 
Weak hits

Sequence:  M3YE43
Domain Number - Region: 64-121
Classification Level Classification E-value
Superfamily Bacterial exopeptidase dimerisation domain 0.0068
Family Bacterial exopeptidase dimerisation domain 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) M3YE43
Sequence length 951
Comment (tr|M3YE43|M3YE43_MUSPF) Bromodomain containing 8 {ECO:0000313|Ensembl:ENSMPUP00000009600} KW=Complete proteome; Reference proteome OX=9669 OS=Mustela putorius furo (European domestic ferret) (Mustela furo). GN=BRD8 OC=Mustelinae; Mustela.
Sequence
MATGTGKHKLLSTGPTEPWSIREKLCLASSVMRSGDQNWVSVSRAIKPFAEPGRPPDWFS
QKHCASQYSELLETTETPKRKRGEKGEVVETVEDVIVRKLTAERVEELKKVIKETQEKYR
RLKRDAELIQAGHMDSRLDELCNDIVMKKKLEEEEAEVKRKATDAAYQARQAVKTPPRRL
PTVMVRSPIDSASPGGDYPLGDLTATTMEEATSGVTPGTLPSTPVTSFPGIPDTLPPGSA
PLEAPMTPVTDDSPQKKMLGQKATPPPSPLLSELLKKGSLLPTSPRLVNESEMAVASGHL
NSTGVLLEVGGVLPMIHGGEMQQTPNTVAASPAASGAPTLSRLLEAGPTQFTTPLTSFTT
VASEPPVKLVPPPVESVSQATIVMMPALPAPSSAPDVSTPESVAPVSQPDTCVPMEAVGD
PHTVTVSMDSSEISMIINSIKEECFRSGVAEAPGGSKAPSIDGKEDLDLAEKMDIAVSYT
GEELDFETVGDIIAIIEDKVDDHPEVLDVAAVEAALSFCEENDDPQSLPGPWEHPIQQER
DKPVSLPAPEMTVKQERLDFEETENKGIHELVDIREPSVEIKMEPAESEQGISGPEIVAG
VVPATSMEPPELRSQDLDEEPRSIATGEIVEADVPSGKGDETPLTTVKTEASPESMLSPS
HGSNPIEDSLEAETQHKFEMSDSLKEESGTIFGSQIKDAPGEDEEEDGVSEAASLEEAKE
EDQGEGYLSEMDNEPPVSESDDGFSIHNATLQSHTLADSIPSSPASSQFSVCSEDQEAIQ
AQKIWKKAIMLVWRAAANHRYANVFLQPVTDDIAPGYHSIVQRPMDLSTIKKNIENGLIR
STAEFQRDIMLMFQNAVMYNSSDHDVYHMAVEMQRDVLEQIQQFLATQLIMQTSESGISA
KSLRGRDSTRKQDSSEKDSVPMGSPAFLLSLFDGGTRGRRCAIEADMKMKK
Download sequence
Identical sequences M3YE43
ENSMPUP00000009600 ENSMPUP00000009600 XP_004744941.1.14098

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]