SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for M3YEA8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  M3YEA8
Domain Number 1 Region: 275-515
Classification Level Classification E-value
Superfamily ClpP/crotonase 6.88e-52
Family Crotonase-like 0.0000000947
Further Details:      
 
Domain Number 2 Region: 8-66
Classification Level Classification E-value
Superfamily Chromo domain-like 2.91e-17
Family Chromo domain 0.0004
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) M3YEA8
Sequence length 531
Comment (tr|M3YEA8|M3YEA8_MUSPF) Chromodomain Y like 2 {ECO:0000313|Ensembl:ENSMPUP00000009665} KW=Complete proteome; Reference proteome OX=9669 OS=Mustela putorius furo (European domestic ferret) (Mustela furo). GN=CDYL2 OC=Mustelinae; Mustela.
Sequence
SLSYLVSQVERIVDKRKNKKGKWEYLIRWKGYGSTEDTWEPEHHLLHCEEFIDEFNGLHV
SKDKRIKSVLVSLTFPCNVKAEVSRFPNQYQQQQQPGGVVWKKPHCSDSSERFPSGPQIR
RNTYHTHRTRIGVPLPGSGPNIVLPPTLSVSTQHIVYVYSSGPRPVEPAHPGVPGTGCTP
VSLCSKLASLLGPAADSCPAVWPLVPTSPSPCAVETGLLVGGPRTGVRFERSALTNGGLN
LHSPVKRKLEAEKDYVFDKRLRYSVRQNESNCRFRDIVVRKEEGFTHILLSSQTSDNNAL
TPEIMKEVRRALCNAATDDSKLLLLSAVGSVFCSGLDYSYLIGRLSSDRRKESTRISEAI
RDFVKAFIQFKKPIVVAINGPALGLGASILPLCDIVWASEKAWFQTPYATIRLTPAGCSS
YTFPQILGVALANEMLLCGRKLTAQEACSRGLVSQVFWPTTFSQEVMLRVKEMASCSAVV
LEESKCLVRSFLKSVLEGVNEKECLMLKQLWSSSKGLDSLFSYLQDKIYEV
Download sequence
Identical sequences M3YEA8
ENSMPUP00000009665 ENSMPUP00000009665

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]