SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for M3YEN6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  M3YEN6
Domain Number 1 Region: 134-191
Classification Level Classification E-value
Superfamily Homeodomain-like 0.00000000000000263
Family Myb/SANT domain 0.00013
Further Details:      
 
Weak hits

Sequence:  M3YEN6
Domain Number - Region: 35-102
Classification Level Classification E-value
Superfamily BRCT domain 0.00414
Family BRCT domain 0.088
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) M3YEN6
Sequence length 401
Comment (tr|M3YEN6|M3YEN6_MUSPF) TERF2 interacting protein {ECO:0000313|Ensembl:ENSMPUP00000009793} KW=Complete proteome; Reference proteome OX=9669 OS=Mustela putorius furo (European domestic ferret) (Mustela furo). GN=TERF2IP OC=Mustelinae; Mustela.
Sequence
MAETMEFGKDPNGLTHSSTLFVREDGSSMSFYVRPSPAKRRVSTLILHGGGTLCRVQEPG
AVLLAQPGEAAAEASGDFISTQYIMDCVDRNERLDLDDYRLGSAADQAPETKAGAQAEGG
AAAAAQSEPQPHGGRIAFTDADDVAILTYVKENARSASSVTGTALWKAMEKSSLTQHSWQ
SLKDRYLKHLRGQEHKYLLGDAPVSPSSQKLKRKAEQDPEAADSGEPQNKRTPDLPEEEY
VKEEIKENDEAVKKMLVEATREFEEIVVDESPDFEIHITMCDDDPPTPEEDSETQPDEDE
EEEEEEKVSAPEVGAAIKIIRQLMEKFNLDLSTVTQAFLKNSGELEATSSFLESGQRADG
YPIWSRQDDLDLQKDDEDARDALVKKFGAQNVARRIEFRKK
Download sequence
Identical sequences M3YEN6
XP_004754029.2.14098 ENSMPUP00000009793 ENSMPUP00000009793

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]