SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for M3YEX4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  M3YEX4
Domain Number 1 Region: 135-280
Classification Level Classification E-value
Superfamily ThrRS/AlaRS common domain 2.62e-32
Family AlaX-like 0.022
Further Details:      
 
Domain Number 2 Region: 37-133
Classification Level Classification E-value
Superfamily Translation proteins 0.0000000000102
Family AlaX-M N-terminal domain-like 0.0027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) M3YEX4
Sequence length 449
Comment (tr|M3YEX4|M3YEX4_MUSPF) Alanyl-tRNA synthetase domain containing 1 {ECO:0000313|Ensembl:ENSMPUP00000009881} KW=Complete proteome; Reference proteome OX=9669 OS=Mustela putorius furo (European domestic ferret) (Mustela furo). GN=AARSD1 OC=Mustelinae; Mustela.
Sequence
MTWIRDAPAVKIVPRGSPSASRRSSVCNFPRPRETVAMAFRCQRDSYAREFTTTVVSCSP
AELQTEGSNGKKEVLNGFHVVLEDTLLFPEGGGQPDDRGSINDVSVLRVTRQGAQADHFT
QTPLAPGTEVQVRVDWERRFDHMQQHSGQHLITAVADHLFGLKTTSWELGRARSVIELDS
PSVTAEQVAAIEQSVNEKIRARLPVNVRELSLDDPEVEQVRGRGLPDDHAGPVRVVTIES
VDANMCCGTHVSNLSDLQVIKILGTEKGKKNKTNLAFLAGNRVLKWMERSHGSEKALTAL
LKCGAEDHVEAVKKLQNSTKLLQKNNLNLLRDLAVHVAHSLRNSPDWGGVVTLHRKEGDS
EFMNIIANEIGSEETLLFLTVGDEKGAGLFLLAGPAEAVETLGPRVAEVLEGKGAGKKGR
FQGKATRMSRRGEVQALLQDYISTQSAEE
Download sequence
Identical sequences M3YEX4
ENSMPUP00000009881 ENSMPUP00000009881

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]