SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for M3YFA0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  M3YFA0
Domain Number 1 Region: 117-238
Classification Level Classification E-value
Superfamily Bromodomain 1.83e-34
Family Bromodomain 0.00086
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) M3YFA0
Sequence length 594
Comment (tr|M3YFA0|M3YFA0_MUSPF) Bromodomain containing 9 {ECO:0000313|Ensembl:ENSMPUP00000010007} KW=Complete proteome; Reference proteome OX=9669 OS=Mustela putorius furo (European domestic ferret) (Mustela furo). GN=BRD9 OC=Mustelinae; Mustela.
Sequence
GRARPEHAGSSLSADYTDKPLEKPLKLVLKVGGSEVTELSGSGHDSSYYDDRSDHERERH
REKKKKKKKKAEKEKHLDDEERRKRKEEKKRKREKEHGDTEGEAEDFDPGKKVEVEPPPD
RPVRACRTQPAEHESTPIQQLLEHFLRQLQRKDPHGFFAFPVTDAIAPGYSMIIKHPMDF
GTMKDKIVANEYKSVTEFKADFKLMCDNAMTYNRPDTVYYKLAKKILHAGFKMMSKQAAL
LGSEDTAVEEPVPEVAPVQVETARKSKRPSREVISCMFEPEGNACSLTDSTAEEHVLALV
EHAADEARDRISRLLPGGKMGYLRKNGDGGLLYSVVNTAEPDADEEETHPVDLSSLSSKL
LPGFTTLGFKDERRGKVTFLSSATTALSTHNSVFGDLKSDETELLYSAYGDETGVQCALS
LQEFVKDAGSYSRKLVDDLLDQITGGDHSRLLFQLRQRRNVPAKPPDEVKAGDSLGDGGS
VLDFMSMKSYSDASLDISAIGSLGKVKKELDADDGHLNLDETAKLLQDLHEAQAERGGSR
PPSNLSSLSNTSPSDRDQHHLGSPSRLSVGEQPEVTHDPYEFLQSPEAAASAKS
Download sequence
Identical sequences M3YFA0
ENSMPUP00000010007 ENSMPUP00000010007

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]