SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for M3YFC1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  M3YFC1
Domain Number 1 Region: 416-473
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 6.55e-26
Family Classic zinc finger, C2H2 0.0037
Further Details:      
 
Domain Number 2 Region: 360-417
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 7.59e-26
Family Classic zinc finger, C2H2 0.0042
Further Details:      
 
Domain Number 3 Region: 304-361
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 8.55e-24
Family Classic zinc finger, C2H2 0.0037
Further Details:      
 
Domain Number 4 Region: 462-514
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 8.95e-22
Family Classic zinc finger, C2H2 0.0029
Further Details:      
 
Domain Number 5 Region: 250-305
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.99e-19
Family Classic zinc finger, C2H2 0.0056
Further Details:      
 
Domain Number 6 Region: 39-92
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 1.1e-17
Family KRAB domain (Kruppel-associated box) 0.0017
Further Details:      
 
Domain Number 7 Region: 213-263
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000194
Family Classic zinc finger, C2H2 0.0071
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) M3YFC1
Sequence length 519
Comment (tr|M3YFC1|M3YFC1_MUSPF) Uncharacterized protein {ECO:0000313|Ensembl:ENSMPUP00000010028} KW=Complete proteome; Reference proteome OX=9669 OS=Mustela putorius furo (European domestic ferret) (Mustela furo). GN= OC=Mustelinae; Mustela.
Sequence
METDLADKPEKRALSSQDSPFSPEQSTEEGEVAALRLTARSQASVTFKDVAMDFTPEEWG
KLDPAQREVMLENYKNLVSLWLPVSKPENYSLENGKEPLVLERKAPKSNYDLETKPEDKD
STSVQDLSNESCQTAIIDRLTRDSVYDSSLETALECENWLENQQGNQERHLREMLSHANS
LPEERAREHDVYWKNLSPKSVLLTQDRAPRGSYAFHTLEKRLKQKSNLMKKQRTCKEKKP
HKCNDCGELFTYHSVLIRHQRVHTGEKPYSCSECGKSFSHRANLTKHQRTHTRILFECSE
CKKAFTESASLAIHQRIHIGERPYECSECGKGFNRSTHLVQHQLIHTGVKPYECNECDKA
FIHSSALIKHQRTHTGEKPYKCQECGKAFSHCSSLTKHQRVHTGEKPYECSECGKTFSQS
THLVQHQRIHTGEKPYECNECGKSFSRSSNFAKHQRIHIGKKPYKCNECGKAFIHSSALI
QHQRTHTGEKPYRCDECGKSFKCSSSLIRHQRIHTEEQL
Download sequence
Identical sequences M3YFC1
ENSMPUP00000010028 XP_004779918.1.14098 XP_004779919.1.14098 ENSMPUP00000010028

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]