SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for M3YFX3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  M3YFX3
Domain Number 1 Region: 4-250
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 1.74e-72
Family IMD domain 0.0023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) M3YFX3
Sequence length 741
Comment (tr|M3YFX3|M3YFX3_MUSPF) MTSS1L, I-BAR domain containing {ECO:0000313|Ensembl:ENSMPUP00000010230} KW=Complete proteome; Reference proteome OX=9669 OS=Mustela putorius furo (European domestic ferret) (Mustela furo). GN=MTSS1L OC=Mustelinae; Mustela.
Sequence
METAEKECGALGGLFQAIVNDMKSSYPIWEDFNSKATKLHSQLRTTVLAAVAFLDAFQKV
ADMATNTRGATRDIGSALTRMCMRHRSIETKLRQFTNALLESLINPLQERIEDWKKSANQ
LDKDHAKEYKRARHEIKKKSSDTLKLQKKARKELLGKGDLQPQLDSALQDVNDMYLLLEE
TEKQAVRRALIEERGRFCTFIAFLQPVVNGELTMLGEITHLQGIIDDLVVLTAEPHKLPP
ASEQVIKDLKGSDYSWSYQTPPSSPGGSGSRKSSMCSTPSSSSGAKGGGAPWPGGAQTYS
PSSTCRYRSLAQPATAAARLSSVSSHDSGFVSQDATYSKPPSPMPSDITSQKSSSSASSE
ASETCQSVSECSSPTSDWAKAGPHEQTSGTSLQRRKDRVEHPRDTEPGLASGGALGPSGE
EAPRPRMSPATIAAKHGEEVSPAASDLAMVLTRGLSLEHQKSSRDSLQYSSGYSTQTTTP
SCSEDTIPSQGSDYDCYSVNGDADGEGPAEFDKSSTIPRNSNIAQNYRRLIQTKRPASTA
GLPSASGAPPGVATIRRTPSTKPAVRRALSSAGPIPIRPPIVPVKTPTVPDSPGYTGPMR
AGSEECVFYSDEAASPLAADLAKASPKRLSLPNTAWASPAPEAAGYPGLAADDDDEQQQL
AANRHSLVEKLGELVAGAHALGEGQFPFPTALASAAAPTETPSPPPAASGDPPAEDMLVA
IRRGVRLRRTVTNDRSAPRIL
Download sequence
Identical sequences M3YFX3
ENSMPUP00000010230 ENSMPUP00000010230 XP_004754093.1.14098

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]