SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for M3YG74 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  M3YG74
Domain Number 1 Region: 254-324
Classification Level Classification E-value
Superfamily Homeodomain-like 2.14e-20
Family Homeodomain 0.0022
Further Details:      
 
Domain Number 2 Region: 97-165
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.000000000000428
Family LIM domain 0.016
Further Details:      
 
Domain Number 3 Region: 65-96
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.00000000291
Family LIM domain 0.0076
Further Details:      
 
Weak hits

Sequence:  M3YG74
Domain Number - Region: 161-190
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.00302
Family LIM domain 0.021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) M3YG74
Sequence length 397
Comment (tr|M3YG74|M3YG74_MUSPF) LIM homeobox 9 {ECO:0000313|Ensembl:ENSMPUP00000010331} KW=Complete proteome; Reference proteome OX=9669 OS=Mustela putorius furo (European domestic ferret) (Mustela furo). GN=LHX9 OC=Mustelinae; Mustela.
Sequence
MEIVGCRAEDNSCPFRPPAMLFHGISGGHIQGIMEEMERRSKTEARLAKGAQLNGRDAVM
PPLSPEKPALCAGCGGKISDRYYLLAVDKQWHLRCLKCCECKLALESELTCFAKDGSIYC
KEDYYRRFSVQRCARCHLGISASEMVMRARDSVYHLSCFTCSTCNKTLTTGDHFGMKDSL
VYCRAHFETLLQGEYPPQLSYTELAAKSGGLALPYFNGTGTVQKGRPRKRKSPALGVDIV
NYNSGCNENEADHLDRDQQPYPPSQKTKRMRTSFKHHQLRTMKSYFAINHNPDAKDLKQL
AQKTGLTKRVLQVWFQNARAKFRRNLLRQENGGVDKADGTSLPAPPSADSGALTPPGTAT
TLTDLTNPTISVVTSVTSNMDSHESGSPSQTTLTNLF
Download sequence
Identical sequences M3YG74
XP_004756269.1.14098 ENSMPUP00000010331 ENSMPUP00000010331

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]