SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for M3YG80 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  M3YG80
Domain Number - Region: 268-319
Classification Level Classification E-value
Superfamily SH3-domain 0.000888
Family SH3-domain 0.0049
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) M3YG80
Sequence length 384
Comment (tr|M3YG80|M3YG80_MUSPF) Uncharacterized protein {ECO:0000313|Ensembl:ENSMPUP00000010337} KW=Complete proteome; Reference proteome OX=9669 OS=Mustela putorius furo (European domestic ferret) (Mustela furo). GN= OC=Mustelinae; Mustela.
Sequence
MASQTPPLTPKPRELGQNSWSLARMKTCPHFQSADLGPTLLTRPGTNTYQNAPPILPRPS
QQTGSSNVNAFRPAYSSFSSRYGACGNAFYGSYRPYSYGDNGLGYNRLCDDLPPRFIQQA
EESSRGAFQSTEIVHVFASLSMMMDATFSAVCCFGAVLDVANHFSQLKIHFTKGFSAFAL
VRTIRYLYKQLQWMMNEDLWAESEGTVACLDDEGRAANSAKSRPMFLFFAIILSSPYLIW
KMLSTHNDEVNMNWASGEDDHILAREYDFAAVSEEISFHAGNMLNLTSQRKQPKVHGSLL
ASLDGQTRLTPCNYVKSLGKKYRAVESSKISKQQQSYNATLIKVATAANSLDELESAFES
VFVETNKVPVAPDPTGKGGDKQDL
Download sequence
Identical sequences M3YG80
ENSMPUP00000010337 ENSMPUP00000010337

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]