SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for M3YGE7 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  M3YGE7
Domain Number 1 Region: 306-547
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 9.18e-71
Family Nuclear receptor ligand-binding domain 0.000000000489
Further Details:      
 
Domain Number 2 Region: 183-262
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 1.43e-28
Family Nuclear receptor 0.0000153
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) M3YGE7
Sequence length 597
Comment (tr|M3YGE7|M3YGE7_MUSPF) Nuclear receptor subfamily 3 group A member 1 {ECO:0000256|PIRNR:PIRNR002527} KW=Complete proteome; Reference proteome OX=9669 OS=Mustela putorius furo (European domestic ferret) (Mustela furo). GN=ESR1 OC=Mustelinae; Mustela.
Sequence
MTMTLHTKASGMALLHQIQGTELEPLNRPQLKIPLERPLGEVYVDSSKPAVYNYPEGGAY
DFNAAPAASAPVYGQSGLSYGPGSEAAAFGANGLGGFQPLNSVSPSPLVLLHPPPQLSPF
LHPHGQQVPYYLENEPSGYAVHEAGPPAFYRPNSDSRRQGGRERLASTSDKGSMAMESAK
ETRYCAVCNDYASGYHYGVWSCEGCKAFFKRSIQGHNDYMCPATNQCTIDKNRRKSCQAC
RLRKCYEVGMMKGGIRKDRRGGRMLKHKRQRDDAEGRNEVGSSGDMRTSNLWPSPLLIKH
TKKNSPALSLTADQMVSALLEAEPPIIYSDYDPSRPFSEASMMGLLTNLADRELVHMINW
AKRVPGFVDLSLHDQVHLLECAWLEILMIGLVWRSMEHPGKLLFAPNLLLDRNQGKCVEG
MVEIFDMLLATSSRFRMMNLQGEEFVCLKSIILLNSGVYTFLSSTLKSLEEKDHIHRVLD
KITDTLIHLMAKAGLTLQQQHRRLAQLLLILSHIRHMSNKGMEHLYSMKCKNVVPLYDLL
LEMLDAHRLHAPAGRGGGSAPMEEMSESQLATTGATSSHSLQAYYITEEAASFPSTV
Download sequence
Identical sequences M3YGE7
ENSMPUP00000010404 ENSMPUP00000010404 XP_012912196.1.14098

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]