SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for M3YGG5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  M3YGG5
Domain Number 1 Region: 55-117
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 3.34e-17
Family LIM domain 0.00092
Further Details:      
 
Domain Number 2 Region: 184-246
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.00000000000000101
Family LIM domain 0.0038
Further Details:      
 
Domain Number 3 Region: 112-149
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.00000000000000105
Family LIM domain 0.00072
Further Details:      
 
Domain Number 4 Region: 242-277
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.0000000000000115
Family LIM domain 0.001
Further Details:      
 
Domain Number 5 Region: 151-183
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.000000448
Family LIM domain 0.011
Further Details:      
 
Domain Number 6 Region: 26-53
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.0000136
Family LIM domain 0.029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) M3YGG5
Sequence length 687
Comment (tr|M3YGG5|M3YGG5_MUSPF) Actin binding LIM protein family member 2 {ECO:0000313|Ensembl:ENSMPUP00000010422} KW=Complete proteome; Reference proteome OX=9669 OS=Mustela putorius furo (European domestic ferret) (Mustela furo). GN=ABLIM2 OC=Mustelinae; Mustela.
Sequence
MGMPRGETVSEPQAAHSPLEKPPSTSILCNTCGNVCKGEVLRVQNKYFHIECFVCKACGC
DLAEGGFFVRQGEYICTRDYQRLYGTRCFSCDQFIEGEVVSALGKTYHPDCFVCATCRLP
FPPGDRVTFNGKECMCQKCSLPKTAGSSAHLSQGLWSCGGCGTEIKNGQSLVALEKHWHL
GCFKCETCGKQLDAEYISKDGLPYCEADYHTKFGIRCDGCEKYITGHVLEAGEKHYHPLC
ALCVRCGRMFAEGEEMYLQGSSIWHPACRQAARTEDKNKETRSSSESIISVPASSTSGSP
SRVIYAKLGDEILDYRDLAALPKSKAIYNIDRPDMISYSPYISHSATGRQSCHESPQVLS
PTLTEGDQDDRSYKQCRTSSPSSTGSVSLGRYTPTSRSPQHYSRPAGTVSVGTSSCLSLS
QHPSPTSVFRHHYIPYFRGSESGRSTPSLSVLSDSKPPPCTYQQAPRHFHVPDTGVKDNI
YRKPPIYKQHAARRPDGEDGIFDQDNRKKTSWLILKGDADTRTNSPDLDSQSLSHSSGTD
RDPLQTMQGDNFYSRLPYSKSDPPPGHGKNGLDHRNANLAPGGADLDASWGTRVPSTESA
PRGLATQCRGWRRVVSPGRDCFCRWTAFPHFLNSHAWLLLCLLQNTRSILMMPSLSPTEF
VSNCPRTWTGPGWRGTCRPRISRKCLG
Download sequence
Identical sequences M3YGG5
ENSMPUP00000010422 ENSMPUP00000010422

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]