SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for M3YGI4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  M3YGI4
Domain Number - Region: 65-138
Classification Level Classification E-value
Superfamily LemA-like 0.0523
Family LemA-like 0.011
Further Details:      
 
Domain Number - Region: 155-257
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 0.0931
Family Arfaptin, Rac-binding fragment 0.096
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) M3YGI4
Sequence length 370
Comment (tr|M3YGI4|M3YGI4_MUSPF) Single-pass membrane protein with coiled-coil domains 2 {ECO:0000313|Ensembl:ENSMPUP00000010441} KW=Complete proteome; Reference proteome OX=9669 OS=Mustela putorius furo (European domestic ferret) (Mustela furo). GN=SMCO2 OC=Mustelinae; Mustela.
Sequence
MALMKLSDRTSLQMMTVGKEQQLTEKNSGFLQNMDAAQGAKQNLLRGFTKMDHILDRSDD
KDNTFSEKPQTAFLHETETTKWNMAELEAEHHRDQQNEWEEQETSQVQHEDPDMSTSLQF
SKENIPELTRENTFFQLNYWNSQMGLQVKELGADHIGWMEKINNIIRKINLTEDTMKRLL
NEVISLEGQIEKLESHQDLGADQGANIEEKIMEIKKQIEEMDNNYVQEDACNEAHELKEK
LIARMKNFYKDMTLISTKLGVYQMQEGKTDSQSPEEMVMEESERLLPQAPPPPSVQNSPA
RVTVWKRALRIFIMFYVLIFTGLSCYILFFDATFIFESLLPTMLGRRRMWELREIIAPFL
NLEVEDLLPS
Download sequence
Identical sequences M3YGI4
XP_012903282.1.14098 ENSMPUP00000010441 ENSMPUP00000010441

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]