SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for M3YGM3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  M3YGM3
Domain Number 1 Region: 9-404
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 4.66e-117
Family Motor proteins 0.000000949
Further Details:      
 
Domain Number 2 Region: 1290-1605
Classification Level Classification E-value
Superfamily WD40 repeat-like 1.1e-56
Family WD40-repeat 0.00016
Further Details:      
 
Domain Number 3 Region: 972-1094
Classification Level Classification E-value
Superfamily Prefoldin 0.0000000000314
Family Prefoldin 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) M3YGM3
Sequence length 1624
Comment (tr|M3YGM3|M3YGM3_MUSPF) Kinesin family member 21B {ECO:0000313|Ensembl:ENSMPUP00000010480} KW=Complete proteome; Reference proteome OX=9669 OS=Mustela putorius furo (European domestic ferret) (Mustela furo). GN=KIF21B OC=Mustelinae; Mustela.
Sequence
MAGQGDCCVKVAVRIRPQLSKEKIEGCHICTSVTPGEPQVLLGKDKAFTYDFVFDLDTWQ
EQIYSTCVSKLIEGCFEGYNATVLAYGQTGAGKTYTMGTGFDTVTSEEEQGIIPRAIAHL
FGGITERKRRAQEQGVAGPEFKVSAQFLELYNEEILDLFDSTRDPDARHRRSNIKIHEDG
NGGIYTTGVTSRLINSQEELIQCLKQGALSRTTASTQMNVQSSRSHAIFTIHVCQMRVCT
QPDPVNEVVTGLPEGTAPTSEYETLTAKFHFVDLAGSERLKRTGATGERAKEGISINCGL
LALGNVISALGDQSKKVVHVPYRDSKLTRLLQDSLGGNSQTIMIACVSPSDRDFMETLNT
LKYANRARNIKNKVVVNQDKTSQQISALRAEIARLQMELMEYKAGKRVIGEDGAEGYSDL
FRENAMLQKENGALRLRVKAMQEAIDAINNRVTHLMSQEANLLLAKAGDGNEAIGALIQN
YIREIEELRTKLLESEAMNESLRRSLSRASARSPYSLGASPGAPAFGGSPASSMEDASEV
IRRAKQDLERLKKKEVRQRRKSPEKEAFKKRAKLQQENSEETDENEAEEEEEERDESGCE
EEEGREDEDEDSGSEESLVDSDSDPDEKEVNFQADLADLTCEIEIKQKLIDELENSQRRL
QTLKHQYEEKLILLQNKIRDTQLERDRVLQNLSTMECYTEEKANKIKADYEKRLREMNRD
LQKLQAAQKEHARLLKNQSRYERELKKLQAEVAEMKKAKVALMKQMREEQQRRRLVETKR
NREIAQLKKEQRRQEFQIRALESQKRQQEIVLRRKTQEVSALRRLAKPMSERVAGRAGLK
PPMLDSGAEVSASTTSSEAESGARSVSSIVRQWNRQINHFLGDHPAPAVNGTRPTRKKFQ
KKGASQSFSKAARLKWQSLERRIIDIVMQRMTIVNLEADMERLIKKREELFLLQEALRRK
RERLQAESPEEEKGLQELAEEIEVLAANIDYINDSITDCQATIVQLEETKEELDSTDTSV
VISSCSLAEARLLLDNFLKASIDKGLQVAQKEAQIRLLEGRLRQTDIAGSSHNHLLLDAL
REKAEAHPELQALINNVQQENGYASTDEEISEFSEGSFSQSFTMKGSTSHDDFKFKGEPK
LSAQMKAVSAECLGPPLDSSTKNITKSLASLVEIKEDGVGLSVRDPYYRDKVSRTISLPS
RGSTFPRQSRGTETSPLTRRKSYDRGQPIRSTDVGFTPPSSPPTRPRNDRNVFSRLTSNQ
SQGSALDKGVITPVGGAKGARTAPLQCVSMAEGHTRPILCLDATDELLFTGSKDRSCKMW
NLVTGQEIAALKGHPNNVVSLKYCSHSGLVFSVSASYIKVWDIRDSAKCIRTLTSSGQVT
SGDACATASTRAITSAQGEHQINQIALSPSGTMLYAASGNAVRIWELSRFQPVGKLTGHI
GPVMCLTVTQTASQHDLVVTGSKDHYVKMFELGECVTGTIGPTHNFEPPHYDGIECLAIQ
GDVLFSGSRDNGIKKWDLEQQELIQQIPNAHKDWVCALAFVPGRPMLLSACRAGVIKVWN
VDNFTPIGEIRGHDSPINAICTNAKHIFTASSDCRVKVWNYVPGLTPCLPRRVLAIKGRA
TTLP
Download sequence
Identical sequences M3YGM3
ENSMPUP00000010480 ENSMPUP00000010480

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]