SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for M3YGZ3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  M3YGZ3
Domain Number 1 Region: 145-386
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 1.57e-66
Family Nuclear receptor ligand-binding domain 0.0000149
Further Details:      
 
Domain Number 2 Region: 76-158
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 5.6e-31
Family Nuclear receptor 0.000087
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) M3YGZ3
Sequence length 394
Comment (tr|M3YGZ3|M3YGZ3_MUSPF) Nuclear receptor subfamily 2 group F member 2 {ECO:0000313|Ensembl:ENSMPUP00000010600} KW=Complete proteome; Reference proteome OX=9669 OS=Mustela putorius furo (European domestic ferret) (Mustela furo). GN=NR2F2 OC=Mustelinae; Mustela.
Sequence
MAMVVSTWRDPQDEVPGSQGSQASQAPPVPGPPPGAPHTPQTPGQGGPASTPAQTAAGGQ
GGPGGPGGDKQQQQQHIECVVCGDKSSGKHYGQFTCEGCKSFFKRSVRRNLSYTCRANRN
CPIDQHHRNQCQYCRLKKCLKVGMRREAVQRGRMPPTQPTHGQFALTNGDPLNCHSYLSG
YISLLLRAEPYPTSRFGSQCMQPNNIMGIENICELAARMLFSAVEWARNIPFFPDLQITD
QVALLRLTWSELFVLNAAQCSMPLHVAPLLAAAGLHASPMSADRVVAFMDHIRIFQEQVE
KLKALHVDSAEYSCLKAIVLFTSDACGLSDVAHVESLQEKSQCALEEYVRSQYPNQPTRF
GKLLLRLPSLRTVSSSVIEQLFFVRLPRFNNSNF
Download sequence
Identical sequences M3YGZ3
ENSMPUP00000010600 ENSMPUP00000010600

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]