SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for M3YH36 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  M3YH36
Domain Number 1 Region: 269-356
Classification Level Classification E-value
Superfamily SH3-domain 2.63e-22
Family SH3-domain 0.0009
Further Details:      
 
Domain Number 2 Region: 12-76
Classification Level Classification E-value
Superfamily SH3-domain 3.41e-18
Family SH3-domain 0.00089
Further Details:      
 
Domain Number 3 Region: 633-693
Classification Level Classification E-value
Superfamily SH3-domain 2.23e-17
Family SH3-domain 0.0012
Further Details:      
 
Domain Number 4 Region: 73-135
Classification Level Classification E-value
Superfamily SH3-domain 0.00000000000000223
Family SH3-domain 0.0014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) M3YH36
Sequence length 695
Comment (tr|M3YH36|M3YH36_MUSPF) SH3 domain containing ring finger 3 {ECO:0000313|Ensembl:ENSMPUP00000010643} KW=Complete proteome; Reference proteome OX=9669 OS=Mustela putorius furo (European domestic ferret) (Mustela furo). GN=SH3RF3 OC=Mustelinae; Mustela.
Sequence
MEQSAGRETLSQLPYGKALYSYEGKEPGDLKFSKGDIIILRRRVDEHWYHGELHGAHGFL
PASYIQCVRPLPQTPPQGKALYDFEMKDRDQDKDCLTFTKDEILTVIRRVDDNWAEGMLG
DKIGIFPLLYVELNDSAKQLIEMDKPCPGAASGCHASLPSDSGAAASAAPGPALSSTGAV
SAFQRRVDSKKNAKKRHSFTALSVTHKSSQATSHRHSMEISAPVLISSSDPRAAARIGDL
AHLSCSAPAQDSSSSPGPTSAAEQQGTAPKVQLPLNVYLALYAYKPQKNDELELRKGEMY
RVLEKCQDGWFKGTSLRTGLSGVFPGNYVTPVSRAPVGGAGPPRNNVIGGSPLAKGMATT
IHPGGGSLSSPATAIRPSLPLTTPQAQHQIASPPMATCLRHTAQPATSQARGTVPTAAHS
SAQAQDRPTATVSPLRTQNSPSRLPAASLRPHSVVSPQHVHQPPMQTVIGAQCPRPAIPL
TSAASAVTPPNVSAANLNGEAGGGSVSGLSSSSPTNTGCKPDEKKNEKKEKKSGLLKLLA
GASTKKKSRSPPSVSPTHDSQVAVDSSLQGAVGPEVSSLSIHGRAGSCPIESEMQGAVGM
EPLHRKAGSLDLNFSSSPSRQASLSMAAIRPEPKPLSRERYRVVVSYPPQSEAEIELKEG
DIVFVHKKREDGWYKGTLQRNGRTGLFPGSFVESF
Download sequence
Identical sequences M3YH36
ENSMPUP00000010643 ENSMPUP00000010643

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]