SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for M3YH73 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  M3YH73
Domain Number 1 Region: 50-112
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 6.06e-17
Family LIM domain 0.0011
Further Details:      
 
Domain Number 2 Region: 231-294
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 1.99e-16
Family LIM domain 0.001
Further Details:      
 
Domain Number 3 Region: 173-234
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 4.82e-16
Family LIM domain 0.0016
Further Details:      
 
Domain Number 4 Region: 137-171
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.000000000000271
Family LIM domain 0.00044
Further Details:      
 
Domain Number 5 Region: 13-47
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.00000000000527
Family LIM domain 0.0011
Further Details:      
 
Domain Number 6 Region: 108-139
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.0000000000688
Family LIM domain 0.00097
Further Details:      
 
Weak hits

Sequence:  M3YH73
Domain Number - Region: 290-319
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.0148
Family LIM domain 0.025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) M3YH73
Sequence length 337
Comment (tr|M3YH73|M3YH73_MUSPF) LIM and senescent cell antigen-like-containing domain protein {ECO:0000256|PIRNR:PIRNR038003} KW=Complete proteome; Reference proteome OX=9669 OS=Mustela putorius furo (European domestic ferret) (Mustela furo). GN=LIMS1 OC=Mustelinae; Mustela.
Sequence
MLGVAAGMTNSNMANALANATCERCKGGFAPAEKIVNSNGELYHEQCFVCAQCFQQFPEG
LFYEFEGRKYCEHDFQMLFAPCCHQCGEFIIGRVIKAMNNSWHPECFRCDLCEEVLADIG
FVKNAGRHLCRPCHNREKARGLGKYICQKCHAIIDEQPLIFKNDPYHPDHFNCANCGKEL
TADARELKGELYCLPCHDKMGVPICGACRRPIEGRVVNAMGKQWHVEHFVCAKCEKPFLG
HRHYERKGLAYCETHYNQLFGDVCFHCNRVIEGDVVSALNKAWCVNCFACSTCNTKLTLK
NKFVEFDMKPVCKKCYEKFPLELKKRLKKLAETLGRK
Download sequence
Identical sequences M3YH73
ENSMPUP00000010680 ENSMPUP00000010680 XP_012917827.1.14098

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]