SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for M3YHB8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  M3YHB8
Domain Number 1 Region: 102-144
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 4.12e-17
Family LIM domain 0.0013
Further Details:      
 
Domain Number 2 Region: 145-191
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 4.76e-16
Family LIM domain 0.00024
Further Details:      
 
Domain Number 3 Region: 37-83
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.00000000000000178
Family LIM domain 0.00025
Further Details:      
 
Domain Number 4 Region: 9-35
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.000000000156
Family LIM domain 0.0029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) M3YHB8
Sequence length 193
Comment (tr|M3YHB8|M3YHB8_MUSPF) Cysteine and glycine rich protein 1 {ECO:0000313|Ensembl:ENSMPUP00000010725} KW=Complete proteome; Reference proteome OX=9669 OS=Mustela putorius furo (European domestic ferret) (Mustela furo). GN=CSRP1 OC=Mustelinae; Mustela.
Sequence
MPNWGGGKKCGVCQKTVYFAEEVQCEGSSFHKSCFLCMVCKKNLDSTTVAVHGEEIYCKS
CYGKKYGPKGYGYGQGAGTLSTDKGESLGIKHEEAPGHRPTTNPNASKFAQKIGSSERCP
RCSQAVYAAEKVIGAGKSWHKSCFRCAKCGKGLESTTLADKDGEIYCKGCYAKNFGPKGF
GFGQGAGALVHSE
Download sequence
Identical sequences M3YHB8
ENSMPUP00000010725 ENSMPUP00000010725 XP_004756335.1.14098

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]