SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for M3YHE7 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  M3YHE7
Domain Number 1 Region: 129-191
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 1.11e-18
Family LIM domain 0.0016
Further Details:      
 
Domain Number 2 Region: 188-254
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 4e-18
Family LIM domain 0.0023
Further Details:      
 
Domain Number 3 Region: 67-132
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 5.95e-16
Family LIM domain 0.0044
Further Details:      
 
Domain Number 4 Region: 7-72
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.00000000000000157
Family LIM domain 0.019
Further Details:      
 
Domain Number 5 Region: 250-278
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.000000000055
Family LIM domain 0.0012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) M3YHE7
Sequence length 279
Comment (tr|M3YHE7|M3YHE7_MUSPF) Four and a half LIM domains 2 {ECO:0000313|Ensembl:ENSMPUP00000010754} KW=Complete proteome; Reference proteome OX=9669 OS=Mustela putorius furo (European domestic ferret) (Mustela furo). GN=FHL2 OC=Mustelinae; Mustela.
Sequence
MTERFDCHHCEESLFGKKYILREDSPYCVACFEALYASTCEECGKPIGCDCKDLSYKDRH
WHEACFQCFRCKSSLVDKPFAAKEDQLLCTDCYSHEYSSKCQECKKTIMPGTRKMEYKDS
SWHETCFVCRRCQQPIGTKSFIPKDNQNFCVPCYEKQYALQCVQCQKPITTGGVTYREQP
WHRECFVCTACKKPLSGQRFTSREEFPYCLSCFCDLYAKKCAGCTHPISGLGGTKYISFE
ERQWHNDCFNCKKCSLSLVGRGFLTERDDILCPDCGKDI
Download sequence
Identical sequences M3YHE7
XP_004764425.1.14098 XP_004764426.1.14098 XP_004764427.1.14098 XP_004764428.1.14098 XP_004764429.1.14098 ENSMPUP00000010754 ENSMPUP00000010754

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]