SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for M3YHE8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  M3YHE8
Domain Number 1 Region: 281-467,537-585
Classification Level Classification E-value
Superfamily Phospholipase D/nuclease 1.06e-38
Family Phospholipase D 0.07
Further Details:      
 
Domain Number 2 Region: 600-794
Classification Level Classification E-value
Superfamily Phospholipase D/nuclease 8.44e-28
Family Nuclease 0.036
Further Details:      
 
Domain Number 3 Region: 62-194
Classification Level Classification E-value
Superfamily PX domain 0.0000000000000445
Family PX domain 0.0093
Further Details:      
 
Domain Number 4 Region: 206-311
Classification Level Classification E-value
Superfamily PH domain-like 0.00000842
Family Pleckstrin-homology domain (PH domain) 0.0091
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) M3YHE8
Sequence length 867
Comment (tr|M3YHE8|M3YHE8_MUSPF) Phospholipase {ECO:0000256|PIRNR:PIRNR009376} KW=Complete proteome; Reference proteome OX=9669 OS=Mustela putorius furo (European domestic ferret) (Mustela furo). GN=PLD2 OC=Mustelinae; Mustela.
Sequence
MAATPASLFSSGDDLDSSQLHMEPDELDTLKEGEDPADRMHPFLAIYDLQPLKMRPLVFA
PGVPVTAQVVGTERYTSGSKVGTCTLYSVRLTHGAFTWTTKKKFRHFQELHRDLLRHKVL
MSLLPLARFGVAHLPAREAADREIPSLPRVGPEGSSRHASSKQKYLENYLNRLLTMSFYR
NYHAMTEFLEVSRLSFIPDLGSKGLEGVIRKRSGGHRVPGLTCCGRDQVCYRWSKRWLVV
KDSFLLYMCLETGAISFVQLFDPGFEVRVGKRSTEARYGVRIDTSHRSLILKCGSYRQAR
WWGQEITELAQGPGRDFIQLHRHDSYAPPRPGTLARWFVNGAGYFAAVADAILRAQEEIF
ITDWWLSPEIYLKRPAHSDDWRLDIMLKRKAEEGVRVSVLLFKEVELALGINSGYSKRAL
MLLHHNIKVMRHPDQVTLWAHHEKLLVVDQVVAFLGGLDLAYGRWDDLHYRLTDLGDPSG
PAAPQPPPPGSDSPGSPDLSQNQFFWLGKDYSNLITKDWVQLDRPFEDFIDRETMPRMPW
RDVGVAVHGLPARDLARHFIQRWNFTKMTKAKYKTPMYPYLLPKSTSTADQLPFTLPGGQ
CTTVQVLRSVDRWSAGTLENSILNAYLHTIRESQHFLYIENQFFISCSDGRTVLNKVGDE
IVDRILKAHKQGQCFRVYVLLPLLPGFEGDITTGGGNSIQAILHFTYRTLCRGEYSILHR
LKAAMGTAWRDYMSICGLRTHGELGGHPVSELIYIHSKMLIADDRTVIIGSANINDRSLL
GKRDSELAVLIQDTEMEPSLMDGRDYQAGRFALSLRKHCFSVILGADARPDLDLRDPVCD
DFFQLWQDTAENNANIYEQMLELNLRD
Download sequence
Identical sequences M3YHE8
ENSMPUP00000010755 ENSMPUP00000010755

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]