SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for M3YHR4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  M3YHR4
Domain Number 1 Region: 12-296
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 4.86e-63
Family Protein kinases, catalytic subunit 0.00013
Further Details:      
 
Domain Number 2 Region: 435-518
Classification Level Classification E-value
Superfamily DEATH domain 2.87e-17
Family Caspase recruitment domain, CARD 0.0051
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) M3YHR4
Sequence length 538
Comment (tr|M3YHR4|M3YHR4_MUSPF) Tyrosine-protein kinase RIPK2 {ECO:0000256|PIRNR:PIRNR037921} KW=Complete proteome; Reference proteome OX=9669 OS=Mustela putorius furo (European domestic ferret) (Mustela furo). GN=RIPK2 OC=Mustelinae; Mustela.
Sequence
MNREGICSALPTIPCHKLADLRYLSRGASGTVSSARHADWRVQVAVKQLHIHTPLLDSER
NDVLREAEILHKARFSYILPILGICNEPEFLGIVTEYMPNGSLNELLHRKTEYPDVAWPL
RFRILHEIALGVNYLHNMNPPLLHHDLKTQNILLDNEFHVKIADFGLSKWRMMSLSQSRT
SKSSPEGGTIIYMPPENYEPGQKSRASIKHDIYSFAVIMWEVLSRKQPFEEVTNPLQIMY
SVSQGHRPNTNEESLPLDIPHRTLMISLIESGWAQNPDERPSFLKCLIELEPVLRTFEEI
AFLEAVIQLKKTKLQSTLSTIHLCDMKKMDSSLNTPITHGPQEESCGSSQLHESSDSAIA
SKSLTAPQENDFLSRKTQDFSTLCHYPVNHSCNSNISAVQKRTFCDHKTTPGSSAVITPL
SAEGNSERLQPGIAQQWIQSKREDIVSQMTEACLNQSLDALLSRDLLMKEDYELISTKPT
RTSKVRQLLDTTDIQGEEFAKVIVQKLKDNKQMGLQPYPEILVVSRSQSLYLFQNKSS
Download sequence
Identical sequences M3YHR4
ENSMPUP00000010871 ENSMPUP00000010871

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]