SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for M3YHR7 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  M3YHR7
Domain Number 1 Region: 241-303
Classification Level Classification E-value
Superfamily Homeodomain-like 2.21e-20
Family Homeodomain 0.0033
Further Details:      
 
Domain Number 2 Region: 123-189
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.0000000000000207
Family LIM domain 0.01
Further Details:      
 
Domain Number 3 Region: 90-121
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.000000803
Family LIM domain 0.033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) M3YHR7
Sequence length 377
Comment (tr|M3YHR7|M3YHR7_MUSPF) LIM homeobox 8 {ECO:0000313|Ensembl:ENSMPUP00000010874} KW=Complete proteome; Reference proteome OX=9669 OS=Mustela putorius furo (European domestic ferret) (Mustela furo). GN=LHX8 OC=Mustelinae; Mustela.
Sequence
MYWKSDQMFVCKLEEKDVPELAVPTEKCQGLMSEECGRIAALAAGRTRKGAGEEGLVSPE
GAGDEDSCSSSAPLSPSSSPRSMASGSVCPPGKCVCNSCGLEIVDKYLLKVNDLCWHVRC
LSCSVCRTSLGRHTSCYIKDKDIFCKLDYFRRYGTRCSRCGRHIHSTDWVRRAKGNVYHL
ACFACFSCKRQLSTGEEFALVEEKVLCRVHYDCMLDNLKREVENGNGISVEGALLTEQDV
NHPKPAKRARTSFTADQLQVMQAQFAQDNNPDAQTLQKLAERTGLSRRVIQVWFQNCRAR
HKKHVSPNHSSSAPVTAVPPSRLSPPMLEEMVYSAYVPQDGTMLTALHSYMDAHSPTTLG
LQPLLPHSMTQLPISHT
Download sequence
Identical sequences M3YHR7
ENSMPUP00000010874 XP_004758236.1.14098 ENSMPUP00000010874

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]