SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for M3YI20 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  M3YI20
Domain Number 1 Region: 7-160
Classification Level Classification E-value
Superfamily PH domain-like 2.12e-55
Family Phosphotyrosine-binding domain (PTB) 0.000000387
Further Details:      
 
Domain Number 2 Region: 174-297
Classification Level Classification E-value
Superfamily PDZ domain-like 4.93e-20
Family PDZ domain 0.0000769
Further Details:      
 
Domain Number 3 Region: 289-371
Classification Level Classification E-value
Superfamily PDZ domain-like 0.00000000000000103
Family PDZ domain 0.0000324
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) M3YI20
Sequence length 380
Comment (tr|M3YI20|M3YI20_MUSPF) Uncharacterized protein {ECO:0000313|Ensembl:ENSMPUP00000010977} KW=Complete proteome; Reference proteome OX=9669 OS=Mustela putorius furo (European domestic ferret) (Mustela furo). GN= OC=Mustelinae; Mustela.
Sequence
PGPCEPEDLIDGIIFAANYLGSTQLLSERNPSKNIRMMQAQEAVSRVKNSEGDAQTLTEV
DLFISTQRIKVLNADTQETMMDHALRTISYIADIGNIVVLMARRRMPRSASQDCIETTPG
AQEGKKQYKMICHVFESEDAQLIAQSIGQAFSVAYQEFLRANGINPEDLSQKEYSDIINT
QEMYNDDLIHFSNSENCKELQLEKHKGEILGVVVVESGWGSILPTVILANMMNGGPAARS
GKLSIGDQIMSINGTSLVGLPLATCQGIIKGLKNQTQVKLNIVSCPPVTTVLIKRPDLKY
QLGFSVQNGIICSLMRGGIAERGGVRVGHRIIEINGQSVVATAHEKIVQALSNSVGEIHM
KTMPAAMFRLLTGQETPLYI
Download sequence
Identical sequences M3YI20
ENSMPUP00000010977 ENSMPUP00000010977

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]